StarFunc result for job id O94823

User Input

>input (1461 residues)
MALSVDSSWHRWQWRVRDGFPHCPSETTPLLSPEKGRQSYNLTQQRVVFPNNSIFHQDWE
EVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITML
PLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKC
NEIVPADILLLFSSDPNGICHLETASLDGETNLKQRCVVKGFSQQEVQFEPELFHNTIVC
EKPNNHLNKFKGYMEHPDQTRTGFGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNS
GPRYKRSKIERRMNIDIFFCIGILILMCLIGAVGHSIWNGTFEEHPPFDVPDANGSFLPS
ALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFFLSNDLDLYDEETDLSIQCRALNI
AEDLGQIQYIFSDKTGTLTENKMVFRRCTIMGSEYSHQENAKRLETPKELDSDGEEWTQY
QCLSFSARWAQDPATMRSQKGAQPLRRSQSARVPIQGHYRQRSMGHRESSQPPVAFSSSI
EKDVTPDKNLLTKVRDAALWLETLSDSRPAKASLSTTSSIADFFLALTICNSVMVSTTTE
PRQRVTIKPSSKALGTSLEKIQQLFQKLKLLSLSQSFSSTAPSDTDLGESLGANVATTDS
DERDDASVCSGGDSTDDGGYRSSMWDQGDILESGSGTSLEEALEAPATDLARPEFCYEAE
SPDEAALVHAAHAYSFTLVSRTPEQVTVRLPQGTCLTFSLLCTLGFDSVRKRMSVVVRHP
LTGEIVVYTKGADSVIMDLLEDPACVPDINMEKKLRKIRARTQKHLDLYARDGLRTLCIA
KKVVSEEDFRRWASFRREAEASLDNRDELLMETAQHLENQLTLLGATGIEDRLQEGVPDT
IATLREAGIQLWVLTGDKQETAVNIAHSCRLLNQTDTVYTINTENQETCESILNCALEEL
KQFRELQKPDRKLFGFRLPSKTPSITSEAVVPEAGLVIDGKTLNAIFQGKLEKKFLELTQ
YCRSVLCCRSTPLQKSMIVKLVRDKLRVMTLSIGDGANDVSMIQAADIGIGISGQEGMQA
VMSSDFAITRFKHLKKLLLVHGHWCYSRLARMVVYYLYKNVCYVNLLFWYQFFCGFSSST
MIDYWQMIFFNLFFTSLPPLVFGVLDKDISAETLLALPELYKSGQNSECYNLSTFWISMV
DAFYQSLICFFIPYLAYKGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTIFHGVVLLG
SFLMYFLVSLLYNATCVICNSPTNPYWVMEGQLSNPTFYLVCFLTPVVALLPRYFFLSLQ
GTCGKSLISKAQKIDKLPPDKRNLEIQSWRSRQRPAPVPEVARPTHHPVSSITGQDFSAS
TPKSSNPPKRKHVEESVLHEQRCGTECMRDDSCSGDSSAQLSSGEHLLGPNRIMAYSRGQ
TDMCRCSKRSSHRRSQSSLTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60312	0.750	0.732	0.000	1499	0.471	0.459	O60312.pdb.gz	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
2	AFDB:O94823	1.000	1.000	0.000	1461	1.000	1.000	O94823.pdb.gz	AT10B_HUMAN Phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=1 SV=2
3	AFDB:Q7KTG6	0.687	0.663	0.000	1517	0.357	0.343	Q7KTG6.pdb.gz	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
4	AFDB:Q8K2X1	0.758	0.782	0.000	1416	0.497	0.513	Q8K2X1.pdb.gz	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
5	AFDB:Q9P241	0.782	0.800	0.000	1426	0.495	0.507	Q9P241.pdb.gz	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
6	AFDB:O18182	0.702	0.726	3.483E-104	1411	0.350	0.363	O18182.pdb.gz	O18182_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-3 PE=1 SV=3
7	AFDB:P98204	0.683	0.854	1.684E-96	1158	0.296	0.373	P98204.pdb.gz	ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ALA1 PE=2 SV=1
8	AFDB:Q9VGD4	0.640	0.546	8.756E-94	1726	0.311	0.264	Q9VGD4.pdb.gz	Q9VGD4_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=2
9	AFDB:Q7YXV5	0.666	0.761	9.342E-93	1270	0.294	0.338	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
10	AFDB:P98198	0.647	0.774	4.760E-91	1209	0.294	0.356	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
11	PDB:7kycA	0.643	0.786	1.800E-79	1178	0.279	0.346	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
12	PDB:7py4A	0.603	0.778	2.801E-77	1112	0.285	0.375	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
13	PDB:7vghB	0.615	0.749	1.365E-75	1183	0.291	0.359	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
14	PDB:7kyaA	0.632	0.774	3.050E-75	1174	0.274	0.341	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:6rohA	0.633	0.819	1.065E-74	1112	0.279	0.367	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
16	PDB:7bspA	0.598	0.828	6.696E-67	1028	0.251	0.356	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
17	PDB:6k7lA	0.583	0.839	7.656E-67	992	0.262	0.386	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
18	PDB:6lknA	0.591	0.790	8.505E-64	1064	0.250	0.343	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.561	0.855	8.565E-57	929	0.187	0.294	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.506	0.882	1.198E-46	816	0.201	0.360	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18182	0.0	856	1411	0.350	0.363	O18182_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-3 PE=1 SV=3
2	O60312	0.0	1301	1499	0.472	0.460	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
3	O94823	0.0	3050	1461	1.000	1.000	AT10B_HUMAN Phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=1 SV=2
4	Q8K2X1	0.0	1413	1416	0.503	0.519	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
5	Q9P241	0.0	1418	1426	0.493	0.505	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
6	Q7KTG5	1.13e-167	545	1494	0.197	0.193	Q7KTG5_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=DmCG33298 PE=3 SV=1
7	Q7KTG6	1.80e-166	543	1517	0.196	0.189	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
8	Q95S66	2.29e-158	493	585	0.178	0.444	Q95S66_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=2 SV=1
9	A0A5K1VW70	8.80e-134	446	1190	0.168	0.206	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
10	P98198	9.81e-134	446	1209	0.168	0.203	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
11	O94296	2.12e-133	446	1258	0.168	0.196	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
12	P98199	4.22e-133	444	1209	0.168	0.203	AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus OX=10090 GN=Atp8b2 PE=1 SV=2
13	Q5ASQ8	1.42e-130	443	1501	0.169	0.165	Q5ASQ8_EMENI Phospholipid-transporting ATPase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8672.2 PE=3 SV=1
14	P39524	1.98e-130	440	1355	0.166	0.179	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
15	Q2KG18	1.10e-129	441	1524	0.169	0.162	Q2KG18_MAGO7 Phospholipid-transporting ATPase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g517 PE=3 SV=1
16	Q8TF62	1.48e-128	431	1192	0.165	0.202	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
17	A3FIN4	1.11e-126	426	1183	0.165	0.204	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
18	C7EXK4	3.02e-126	424	1148	0.166	0.211	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
19	F1LUT4	4.18e-126	419	984	0.162	0.240	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
20	A0A8I5ZKC1	4.45e-126	419	985	0.162	0.240	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	4.1e-05	34.9	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	0.86	20.6	E1-E2 ATPase
3	PF00702 Hydrolase	2.6e-07	42.7	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	7.3	17.8	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	1.8e-73	258.9	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	2.8e-19	79.9	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313600

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.853	Cell cycle control protein 50A
2	9606.ENSP00000419663	0.750	Cell cycle control protein 50C
3	9606.ENSP00000450842	0.732	Cell cycle control protein 50B
4	9606.ENSP00000474988	0.663	Trophoblast glycoprotein like
5	9606.ENSP00000480316	0.634	Gamma-tubulin complex component 5
6	9606.ENSP00000232165	0.600	Ubiquitin-protein ligase E3A
7	9606.ENSP00000337618	0.560	Magnesium transporter NIPA2
8	9606.ENSP00000231198	0.548	Probable tRNA(His) guanylyltransferase
9	9606.ENSP00000440982	0.521	Ras GTPase-activating protein 4B
10	9606.ENSP00000283025	0.517	Tektin-5
11	9606.ENSP00000231238	0.506	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046624	0.999	sphingolipid transporter activity
GO:0008525	0.999	phosphatidylcholine transporter activity
GO:0140333	0.999	glycerophospholipid flippase activity
GO:0140345	0.413	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.982	cellular component organization
GO:0061024	0.762	membrane organization
GO:0006996	0.698	organelle organization
GO:0007033	0.593	vacuole organization
GO:0007040	0.575	lysosome organization
GO:0051179	0.444	localization
GO:0006810	0.434	transport
GO:0050789	0.418	regulation of biological process
GO:0050794	0.391	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:1990531	0.992	phospholipid-translocating ATPase complex
GO:0005783	0.931	endoplasmic reticulum
GO:0005886	0.928	plasma membrane
GO:0031090	0.825	organelle membrane
GO:0031982	0.756	vesicle
GO:0005634	0.747	nucleus
GO:0098588	0.688	bounding membrane of organelle
GO:0031410	0.621	cytoplasmic vesicle
GO:0043233	0.576	organelle lumen
GO:0070013	0.563	intracellular organelle lumen
GO:0030659	0.560	cytoplasmic vesicle membrane
GO:0005654	0.494	nucleoplasm
GO:0000323	0.398	lytic vacuole
GO:0010008	0.332	endosome membrane
GO:0098852	0.328	lytic vacuole membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]