StarFunc result for job id O94827

User Input

>input (1006 residues)
MHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEEESSVDGKGDRKSTGLKLS
KKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDI
YLDQSNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGMKDSKSLSLPILRPAGTGPP
ALERVDAQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPTPSSCSLPSGSSGSTNTGD
SWKNRAASRFSGFFSSGPSTSAFGREVDKMEQLEGKLHTYSLFGLPRLPRGLRFDHDSWE
EEYDEDEDEDNACLRLEDSWRELIDGHEKLTRRQCHQQEAVWELLHTEASYIRKLRVIIN
LFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGD
FLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDM
LAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAA
VVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSK
MDVYCFLFTDLLLVTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVG
AYTFQASGQALCRGWVDTIYNAQNQLQQLRAQEPPGSQQPLQSLEEEEDEQEEEEEEEEE
EEEGEDSGTSAASSPTIMRKSSGSPDSQHCASDGSTETLAMVVVEPGDTLSSPEFDSGPF
SSQSDETSLSTTASSATPTSELLPLGPVDGRSCSMDSAYGTLSPTSLQDFVAPGPMAELV
PRAPESPRVPSPPPSPRLRRRTPVQLLSCPPHLLKSKSEASLLQLLAGAGTHGTPSAPSR
SLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDL
PSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTLLLNSTLTASEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94827	1.000	1.000	0.000	1006	1.000	1.000	O94827.pdb.gz	PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=4
2	AFDB:Q66T02	0.490	0.461	0.000	1073	0.855	0.801	Q66T02.pdb.gz	PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1
3	AFDB:F1R1Q2	0.419	0.366	1.083E-81	1157	0.507	0.441	F1R1Q2.pdb.gz	F1R1Q2_DANRE Pleckstrin homology domain-containing family G member 5 isoform X1 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2
4	AFDB:A0A0G2L933	0.441	0.403	4.200E-79	1110	0.501	0.454	A0A0G2L933.pdb.gz	A0A0G2L933_DANRE Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Danio rerio OX=7955 GN=plekhg5b PE=4 SV=2
5	AFDB:P91620	0.189	0.102	1.724E-18	2061	0.162	0.079	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
6	AFDB:D1MYR8	0.237	0.237	6.162E-17	1007	0.137	0.137	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
7	AFDB:Q9ULL1	0.276	0.207	4.963E-16	1385	0.147	0.107	Q9ULL1.pdb.gz	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
8	AFDB:Q9VVC6	0.298	0.155	4.875E-15	2029	0.134	0.067	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
9	PDB:7rx9A	0.172	0.383	5.784E-15	432	0.074	0.171	7rx9A.pdb.gz
10	PDB:4mt6A	0.208	0.446	6.276E-14	389	0.056	0.144	4mt6A.pdb.gz
11	AFDB:Q9VZ85	0.252	0.137	9.733E-12	1984	0.114	0.058	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
12	AFDB:Q6ZNL6	0.177	0.125	1.469E-9	1462	0.108	0.075	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
13	PDB:4gouA	0.163	0.307	6.227E-8	507	0.058	0.114	4gouA.pdb.gz
14	PDB:6u3eA	0.106	0.227	3.775E-5	397	0.046	0.116	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:5yqrA	0.091	0.296	8.782E-5	268	0.022	0.082	5yqrA.pdb.gz
16	PDB:6hhgA	0.090	0.226	2.043E-4	386	0.017	0.044	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:6bbpA	0.076	0.141	3.040E-4	520	0.042	0.081	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:3ljuX	0.089	0.224	4.095E-4	373	0.024	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:4mk0A	0.095	0.146	4.523E-4	631	0.036	0.057	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:6s9wA	0.091	0.210	9.066E-4	411	0.015	0.036	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2L933	0.0	895	1110	0.526	0.477	A0A0G2L933_DANRE Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Danio rerio OX=7955 GN=plekhg5b PE=4 SV=2
2	A0A0R4ISX1	0.0	858	1135	0.456	0.404	A0A0R4ISX1_DANRE Pleckstrin homology domain-containing family G member 5 isoform X3 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=1
3	A0A2R8RLU7	0.0	862	1057	0.456	0.434	A0A2R8RLU7_DANRE Pleckstrin homology domain-containing family G member 5 isoform X4 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=1
4	F1R1Q2	0.0	859	1157	0.456	0.397	F1R1Q2_DANRE Pleckstrin homology domain-containing family G member 5 isoform X1 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2
5	O94827	0.0	2046	1006	1.000	1.000	PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=4
6	Q66T02	0.0	1499	1073	0.845	0.792	PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1
7	Q6RFZ7	0.0	1521	1039	0.845	0.818	PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus OX=10116 GN=Plekhg5 PE=1 SV=1
8	A0A2X0TW08	1.98e-130	415	790	0.237	0.301	A0A2X0TW08_HUMAN PLEKHG6 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=4 SV=1
9	Q3KR16	1.98e-130	415	790	0.237	0.301	PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3
10	F5H731	2.45e-121	382	495	0.190	0.386	F5H731_HUMAN Pleckstrin homology and RhoGEF domain containing G6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=1
11	M9PG56	1.63e-80	282	848	0.151	0.179	M9PG56_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=1
12	Q9VW85	1.11e-79	287	1661	0.151	0.092	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
13	B7Z088	1.16e-79	287	1626	0.151	0.093	B7Z088_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
14	B7Z087	2.58e-79	286	1480	0.151	0.103	B7Z087_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
15	B7Z086	2.59e-79	286	1445	0.151	0.105	B7Z086_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG7323 PE=1 SV=1
16	M9PFQ9	5.37e-79	285	1412	0.151	0.108	M9PFQ9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
17	Q22354	1.17e-58	219	862	0.120	0.140	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
18	Q8SWY9	6.46e-40	156	469	0.083	0.177	Q8SWY9_DROME RH56938p OS=Drosophila melanogaster OX=7227 GN=CG42674 PE=2 SV=1
19	Q6ZR37	5.68e-32	135	691	0.104	0.152	PKHG7_HUMAN Pleckstrin homology domain-containing family G member 7 OS=Homo sapiens OX=9606 GN=PLEKHG7 PE=1 SV=2
20	M0QZR4	9.09e-30	130	968	0.096	0.100	M0QZR4_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15411 PH_10	11	17.7	Pleckstrin homology domain
2	PF16652 PH_13	3.8	18.9	Pleckstrin homology domain
3	PF17838 PH_16	20	16.4	PH domain
4	PF15405 PH_5	9.9	17.7	Pleckstrin homology domain
5	PF02196 RBD	2.8e+02	12.8	Raf-like Ras-binding domain
6	PF00621 RhoGEF	7.8e-31	119.2	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439807	0.959	Multiple PDZ domain protein
2	9606.ENSP00000360200	0.952	InaD-like protein
3	9606.ENSP00000376753	0.949	PDZ domain-containing protein GIPC1
4	9606.ENSP00000364886	0.920	Rho-related GTP-binding protein RhoE
5	9606.ENSP00000400175	0.858	Transforming protein RhoA
6	9606.ENSP00000308461	0.807	Rho-related GTP-binding protein Rho6
7	9606.ENSP00000361027	0.788	Angiomotin
8	9606.ENSP00000314214	0.691	Vesicle-associated membrane protein 2
9	9606.ENSP00000263035	0.678	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
10	9606.ENSP00000222812	0.654	Syntaxin-1A
11	9606.ENSP00000240874	0.644	Kalirin
12	9606.ENSP00000387739	0.644	Angiomotin-like protein 1
13	9606.ENSP00000261681	0.639	MAGUK p55 subfamily member 5
14	9606.ENSP00000263925	0.638	E3 ubiquitin-protein ligase LNX
15	9606.ENSP00000340297	0.612	Rho guanine nucleotide exchange factor 10
16	9606.ENSP00000465638	0.598	Transmembrane protein 100
17	9606.ENSP00000260283	0.584	Rho GTPase-activating protein 20
18	9606.ENSP00000248706	0.582	Ras-like protein family member 11B
19	9606.ENSP00000285735	0.575	Rho-related GTP-binding protein RhoC
20	9606.ENSP00000234313	0.572	Pleckstrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.966	cellular process
GO:0051056	0.939	regulation of small GTPase mediated signal transduction
GO:0048518	0.647	positive regulation of biological process
GO:0048522	0.623	positive regulation of cellular process
GO:0050896	0.524	response to stimulus
GO:0043122	0.503	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007154	0.325	cell communication
GO:0023052	0.324	signaling
GO:0051716	0.320	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.915	membrane
GO:0043229	0.786	intracellular organelle
GO:0071944	0.780	cell periphery
GO:0005886	0.622	plasma membrane
GO:0030054	0.616	cell junction
GO:0043227	0.539	membrane-bounded organelle
GO:0043231	0.319	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]