StarFunc result for job id O94829

User Input

>input (963 residues)
MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWH
FSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVL
TRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTS
RLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCE
ALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNG
DMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLT
LTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETI
DVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGN
PELSVSSVSTLKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSA
LQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDISHHEDDH
EGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDF
APMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLTLFQ
QGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF
FTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLL
SMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYT
ADY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94829	1.000	1.000	0.000	963	1.000	1.000	O94829.pdb.gz	IPO13_HUMAN Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 SV=3
2	AFDB:F1Q9F5	0.973	0.983	1.121E-91	953	0.814	0.823	F1Q9F5.pdb.gz	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
3	PDB:2xwuB	0.750	0.788	3.686E-90	910	0.944	0.999	2xwuB.pdb.gz
4	AFDB:Q9VEC5	0.906	0.899	4.774E-43	971	0.279	0.277	Q9VEC5.pdb.gz	Q9VEC5_DROME Importin-13 OS=Drosophila melanogaster OX=7227 GN=cdm PE=1 SV=1
5	PDB:3zkvA	0.756	0.828	1.876E-32	873	0.246	0.271	3zkvA.pdb.gz
6	PDB:2x1gF	0.766	0.819	5.884E-32	896	0.270	0.290	2x1gF.pdb.gz
7	AFDB:Q9VQG0	0.814	0.839	2.147E-31	932	0.222	0.230	Q9VQG0.pdb.gz	Q9VQG0_DROME LD21546p OS=Drosophila melanogaster OX=7227 GN=Tnpo-SR PE=2 SV=2
8	AFDB:A0A024R794	0.815	0.848	2.567E-31	923	0.210	0.219	A0A024R794.pdb.gz
9	AFDB:Q8GUL2	0.832	0.837	1.588E-30	958	0.205	0.206	Q8GUL2.pdb.gz	MOS14_ARATH Transportin MOS14 OS=Arabidopsis thaliana OX=3702 GN=MOS14 PE=1 SV=1
10	AFDB:C9J7E5	0.825	0.830	2.113E-30	957	0.216	0.217	C9J7E5.pdb.gz	C9J7E5_HUMAN Transportin 3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=1
11	AFDB:Q7ZW13	0.824	0.857	4.476E-30	923	0.215	0.224	Q7ZW13.pdb.gz	Q7ZW13_DANRE Transportin-3 OS=Danio rerio OX=7955 GN=zgc:55409 PE=1 SV=1
12	AFDB:Q9USZ2	0.824	0.830	5.546E-30	955	0.215	0.217	Q9USZ2.pdb.gz	YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2
13	PDB:6gx9A	0.821	0.863	1.990E-29	912	0.219	0.231	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
14	PDB:4c0qA	0.813	0.895	1.556E-27	871	0.212	0.234	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
15	AFDB:Q09796	0.808	0.788	1.658E-26	990	0.204	0.198	Q09796.pdb.gz	KA111_SCHPO Importin beta-like protein kap111 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap111 PE=3 SV=1
16	PDB:4c0qB	0.710	0.903	6.809E-21	749	0.187	0.240	4c0qB.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
17	PDB:6q82A	0.738	0.697	5.136E-19	1027	0.180	0.168	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
18	PDB:3wyfC	0.734	0.686	1.676E-16	1040	0.155	0.143	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
19	PDB:5uwuC	0.702	0.681	3.305E-16	998	0.159	0.153	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
20	PDB:3gjxA	0.725	0.677	3.679E-16	1041	0.157	0.145	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q9F5	0.0	1617	953	0.814	0.823	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
2	O94829	0.0	1979	963	1.000	1.000	IPO13_HUMAN Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 SV=3
3	Q9JM04	0.0	1949	963	0.984	0.984	IPO13_RAT Importin-13 OS=Rattus norvegicus OX=10116 GN=Ipo13 PE=2 SV=1
4	Q9VEC5	4.91e-132	424	971	0.281	0.279	Q9VEC5_DROME Importin-13 OS=Drosophila melanogaster OX=7227 GN=cdm PE=1 SV=1
5	Q9VQG0	1.05e-51	199	932	0.235	0.242	Q9VQG0_DROME LD21546p OS=Drosophila melanogaster OX=7227 GN=Tnpo-SR PE=2 SV=2
6	Q7ZW13	1.61e-45	179	923	0.211	0.220	Q7ZW13_DANRE Transportin-3 OS=Danio rerio OX=7955 GN=zgc:55409 PE=1 SV=1
7	Q9Y5L0	1.15e-44	177	923	0.201	0.210	TNPO3_HUMAN Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=3
8	Q9USZ2	3.48e-41	166	955	0.217	0.219	YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2
9	C9J7E5	6.40e-41	165	957	0.208	0.209	C9J7E5_HUMAN Transportin 3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=1
10	Q8GUL2	5.84e-37	152	958	0.219	0.220	MOS14_ARATH Transportin MOS14 OS=Arabidopsis thaliana OX=3702 GN=MOS14 PE=1 SV=1
11	E9PFH4	1.81e-32	138	857	0.173	0.195	E9PFH4_HUMAN Transportin 3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=1
12	Q99189	9.24e-25	114	972	0.221	0.219	MTR10_YEAST mRNA transport regulator MTR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR10 PE=1 SV=1
13	Q09796	3.09e-15	83.2	990	0.091	0.089	KA111_SCHPO Importin beta-like protein kap111 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap111 PE=3 SV=1
14	P14068	7.94e-11	68.9	1078	0.125	0.111	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
15	E7F0E8	4.73e-09	62.8	1071	0.123	0.110	E7F0E8_DANRE Exportin 1 (CRM1 homolog, yeast) a OS=Danio rerio OX=7955 GN=xpo1a PE=1 SV=2
16	O14980	4.81e-09	62.8	1071	0.123	0.110	XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1
17	Q9PW90	4.65e-08	59.7	1071	0.126	0.113	Q9PW90_XENLA CRM1/XPO1 protein OS=Xenopus laevis OX=8355 PE=2 SV=1
18	C8VRM0	1.53e-07	58.2	1072	0.048	0.043	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
19	P30822	5.47e-07	56.2	1084	0.123	0.109	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
20	Q80U96	6.63e-07	55.8	1071	0.126	0.113	XPO1_RAT Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03810 IBN_N	9.9e-06	36.7	Importin-beta N-terminal domain
2	PF18773 Importin_rep	5.4e-19	79.0	Importin 13 repeat
3	PF18786 Importin_rep_2	1.2e-44	161.1	Importin 13 repeat
4	PF18806 Importin_rep_3	2.1e-21	87.1	Importin 13 repeat
5	PF08389 Xpo1	1.9e-24	97.8	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010370199.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353289.1	0.982	RAN, member RAS oncogene family
2	61622.XP_010386100.1	0.976	Belongs to the ubiquitin-conjugating enzyme family.
3	61622.XP_010372739.1	0.946	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.
4	61622.XP_010378009.1	0.880	Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits
5	61622.XP_010382934.1	0.880	Eukaryotic translation initiation factor 1A
6	61622.XP_010370061.1	0.869	Eukaryotic translation initiation factor 1A, Y-chromosomal isoform X1
7	61622.XP_010358024.1	0.809	Protein mago nashi homolog 2-like
8	61622.XP_010369691.1	0.809	Mago homolog B, exon junction complex core component
9	61622.XP_010370559.1	0.809	Mago homolog, exon junction complex core component
10	61622.XP_010375623.1	0.772	Eukaryotic translation initiation factor 5A-1 isoform X1
11	61622.XP_010356630.1	0.769	Paired box 6
12	61622.XP_010362351.1	0.705	Eukaryotic translation initiation factor 5A2
13	61622.XP_010365019.1	0.701	Belongs to the small GTPase superfamily. Arf family.
14	61622.XP_010383513.1	0.687	Importin-11
15	61622.XP_010359556.1	0.673	Exportin-4 isoform X1
16	61622.XP_010356942.1	0.666	Importin-8
17	61622.XP_010383134.1	0.657	Importin 7
18	61622.XP_010377162.1	0.646	Importin 9
19	61622.XP_010384586.1	0.640	Belongs to the ubiquitin-conjugating enzyme family.
20	61622.XP_010377662.1	0.622	Karyopherin subunit beta 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140142	0.747	nucleocytoplasmic carrier activity
GO:0097159	0.369	organic cyclic compound binding
GO:1901363	0.368	heterocyclic compound binding
GO:0003676	0.342	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006913	0.985	nucleocytoplasmic transport
GO:0034504	0.976	protein localization to nucleus
GO:0051170	0.976	import into nucleus
GO:0006886	0.975	intracellular protein transport
GO:0006606	0.963	protein import into nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0031981	0.951	nuclear lumen
GO:0032991	0.926	protein-containing complex
GO:0005829	0.924	cytosol
GO:0005654	0.466	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]