StarFunc result for job id O94832

User Input

>input (1006 residues)
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGR
DTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIA
AITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSS
INDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSII
AELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRIN
DIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLG
KHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLRRFEEALQTIF
NRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F9L8	0.963	0.965	0.000	1004	0.807	0.809	E7F9L8.pdb.gz	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
2	AFDB:F1PRN2	0.982	0.982	0.000	1006	0.984	0.984	F1PRN2.pdb.gz	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
3	AFDB:Q23978	0.866	0.862	0.000	1011	0.537	0.534	Q23978.pdb.gz	MY31D_DROME Unconventional myosin ID OS=Drosophila melanogaster OX=7227 GN=Myo31DF PE=1 SV=1
4	AFDB:Q5SUA5	0.953	0.937	0.000	1024	0.603	0.593	Q5SUA5.pdb.gz	MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus OX=10090 GN=Myo1g PE=1 SV=1
5	AFDB:Q03479	0.780	0.781	5.176E-95	1005	0.421	0.422	Q03479.pdb.gz	MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoE PE=1 SV=2
6	AFDB:O88329	0.683	0.660	1.007E-91	1043	0.415	0.400	O88329.pdb.gz	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
7	AFDB:P47807	0.687	0.662	2.876E-91	1045	0.409	0.393	P47807.pdb.gz	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
8	AFDB:Q23979	0.714	0.694	3.010E-91	1035	0.395	0.384	Q23979.pdb.gz	MY61F_DROME Unconventional myosin IC OS=Drosophila melanogaster OX=7227 GN=Myo61F PE=1 SV=3
9	AFDB:Q9UBC5	0.682	0.658	9.418E-91	1043	0.404	0.389	Q9UBC5.pdb.gz	MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens OX=9606 GN=MYO1A PE=1 SV=1
10	AFDB:O00159	0.711	0.674	2.046E-90	1063	0.411	0.389	O00159.pdb.gz	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
11	PDB:4pa0A	0.572	0.590	1.765E-53	974	0.257	0.266	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4anjA	0.560	0.566	1.314E-52	995	0.245	0.247	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
13	PDB:4pa0B	0.580	0.631	3.585E-52	920	0.254	0.278	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.582	0.613	3.135E-50	952	0.250	0.265	4p7hB.pdb.gz
15	PDB:6ycxB	0.577	0.705	4.122E-50	817	0.217	0.267	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.579	0.644	6.577E-42	896	0.277	0.311	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.532	0.558	3.256E-39	954	0.288	0.304	5tbyA.pdb.gz
18	PDB:3uzsA	0.083	0.131	4.499E-3	609	0.015	0.025	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:4mk0A	0.082	0.124	6.480E-3	631	0.011	0.017	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:5yqrA	0.086	0.286	1.473E-2	268	0.023	0.086	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	697	1069	0.410	0.385	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	697	1068	0.410	0.386	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A0A3B3IU30	1261	967	0.587	0.611	A0A3B3IU30_HUMAN Myosin IG OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=1
4	A5PF48	669	1026	0.416	0.407	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
5	B0I1S9	726	1136	0.382	0.338	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
6	B0I1T2	1295	1018	0.607	0.600	MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=2
7	E7F5R7	697	1043	0.410	0.395	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
8	E7F9L8	1706	1004	0.808	0.810	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
9	E7FDV0	561	1117	0.307	0.277	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
10	E9PDF6	726	1107	0.382	0.347	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
11	E9Q634	576	1107	0.304	0.276	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
12	F1PRN2	2074	1006	0.984	0.984	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
13	F5H6E2	717	1039	0.417	0.403	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
14	O00159	717	1063	0.417	0.394	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
15	O43795	726	1136	0.382	0.338	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
16	O88329	734	1043	0.403	0.388	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
17	O94832	2100	1006	1.000	1.000	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
18	P22467	625	994	0.347	0.351	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
19	P34092	567	1111	0.318	0.288	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
20	P34109	589	1109	0.327	0.297	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.1e+02	13.7	AAA ATPase domain
2	PF13238 AAA_18	88	15.1	AAA domain
3	PF13401 AAA_22	1.6e+02	14.0	AAA domain
4	PF00612 IQ	0.4	21.6	IQ calmodulin-binding motif
5	PF00063 Myosin_head	3.2e-239	807.4	Myosin head (motor domain)
6	PF06017 Myosin_TH1	2e-41	153.3	Unconventional myosin tail, actin- and lipid-binding
7	PF00158 Sigma54_activat	2.1e+02	13.1	Sigma-54 interaction domain
8	PF06414 Zeta_toxin	91	13.9	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337040	0.769	Protein unc-119 homolog A
2	9606.ENSP00000482620	0.769	Rab11 family-interacting protein 4
3	9606.ENSP00000262457	0.751	Inversin
4	9606.ENSP00000379691	0.748	Pyridoxal-dependent decarboxylase domain-containing protein 1
5	9606.ENSP00000365756	0.726	Uncharacterized protein KIAA2013
6	9606.ENSP00000458162	0.721	Actin, cytoplasmic 2
7	9606.ENSP00000364585	0.717	Protein RCC2
8	9606.ENSP00000409279	0.713	OTU domain-containing protein 4
9	9606.ENSP00000349960	0.707	Actin, cytoplasmic 1
10	9606.ENSP00000359664	0.693	Di-N-acetylchitobiase
11	9606.ENSP00000400057	0.690	Isoaspartyl peptidase/L-asparaginase
12	9606.ENSP00000228820	0.683	Poly [ADP-ribose] polymerase 11
13	9606.ENSP00000344456	0.677	Catenin beta-1
14	9606.ENSP00000262370	0.674	E3 ubiquitin-protein ligase MGRN1
15	9606.ENSP00000356224	0.619	Nesprin-1
16	9606.ENSP00000005257	0.594	Ras-related protein Ral-A
17	9606.ENSP00000298910	0.554	Leucine-rich repeat serine/threonine-protein kinase 2
18	9606.ENSP00000372023	0.520	Serine/threonine-protein kinase Chk2
19	9606.ENSP00000378152	0.513	AKT-interacting protein
20	9606.ENSP00000367658	0.503	Actin related protein T2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	0.997	cytoskeletal motor activity
GO:0005515	0.997	protein binding
GO:0140657	0.991	ATP-dependent activity
GO:0008092	0.986	cytoskeletal protein binding
GO:0000146	0.984	microfilament motor activity
GO:0003779	0.956	actin binding
GO:0005543	0.844	phospholipid binding
GO:0043168	0.780	anion binding
GO:0019904	0.729	protein domain specific binding
GO:0044877	0.595	protein-containing complex binding
GO:0035091	0.444	phosphatidylinositol binding
GO:0005516	0.343	calmodulin binding
GO:1901363	0.335	heterocyclic compound binding
GO:0097159	0.326	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032502	0.930	developmental process
GO:0051179	0.890	localization
GO:0048856	0.862	anatomical structure development
GO:0032501	0.832	multicellular organismal process
GO:0051641	0.723	cellular localization
GO:0050789	0.555	regulation of biological process
GO:0050794	0.495	regulation of cellular process
GO:0007275	0.460	multicellular organism development
GO:0060322	0.379	head development
GO:0071840	0.335	cellular component organization or biogenesis
GO:0016043	0.326	cellular component organization
GO:0048731	0.312	system development
GO:0050896	0.302	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.996	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0016020	0.993	membrane
GO:0071944	0.991	cell periphery
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0012505	0.980	endomembrane system
GO:0005886	0.979	plasma membrane
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005576	0.966	extracellular region
GO:0120025	0.938	plasma membrane bounded cell projection
GO:0032991	0.932	protein-containing complex
GO:0005615	0.900	extracellular space
GO:0031982	0.890	vesicle
GO:0005829	0.884	cytosol
GO:0005856	0.855	cytoskeleton
GO:0005634	0.826	nucleus
GO:0070062	0.805	extracellular exosome
GO:0031410	0.692	cytoplasmic vesicle
GO:0098862	0.672	cluster of actin-based cell projections
GO:0015629	0.578	actin cytoskeleton
GO:0031981	0.476	nuclear lumen
GO:0005654	0.442	nucleoplasm
GO:0030054	0.390	cell junction
GO:0031256	0.381	leading edge membrane
GO:0016459	0.370	myosin complex
GO:0098590	0.341	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.984	myosin ATPase.

[back to server]