StarFunc result for job id O94842

User Input

>input (621 residues)
MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFD
DLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANP
PVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPT
SSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNEPQKPVSAYALFFRDTQAA
IKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQECQATV
ETVELDPAPPSQTPSPPPMATVDPASPAPASIEPPALSPSIVVNSTLSSYVANQASSGAG
GQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVT
RSVLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKV
RINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEM
ITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKH
CRDVFLAWVASRNSNTVVFVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94842	0.999	0.999	1.664E-87	621	1.000	1.000	O94842.pdb.gz	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
2	PDB:1j5nA	0.115	0.595	6.418E-5	93	0.052	0.344	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
3	AFDB:P40657	0.096	0.077	2.363E-4	784	0.143	0.114	P40657.pdb.gz	SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster OX=7227 GN=Sox15 PE=2 SV=2
4	AFDB:P32519	0.052	0.052	1.534E-3	619	0.163	0.163	P32519.pdb.gz	ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1 PE=1 SV=2
5	AFDB:G3V9V2	0.056	0.057	3.328E-3	615	0.153	0.154	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
6	AFDB:Q9EQY2	0.058	0.056	3.550E-3	579	0.150	0.161	Q9EQY2.pdb.gz
7	AFDB:Q99607	0.057	0.054	4.307E-3	663	0.180	0.169	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
8	AFDB:Q9Z2U4	0.054	0.052	5.227E-3	655	0.161	0.153	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
9	AFDB:Q386B7	0.070	0.061	9.964E-3	729	0.126	0.107	Q386B7.pdb.gz	Q386B7_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1470 PE=4 SV=1
10	AFDB:Q58EM1	0.078	0.082	1.063E-2	582	0.151	0.162	Q58EM1.pdb.gz
11	AFDB:Q24248	0.057	0.051	1.899E-2	717	0.164	0.142	Q24248.pdb.gz	ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster OX=7227 GN=ara PE=1 SV=2
12	PDB:7ploI	0.075	0.102	6.105E-1	451	0.013	0.018	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:6zheC	0.060	0.054	2.524	705	0.034	0.030	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
14	PDB:1kw2A	0.053	0.072	2.692	455	0.013	0.018	1kw2A.pdb.gz
15	PDB:1lotA	0.052	0.074	2.871	436	0.013	0.018	1lotA.pdb.gz	Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
16	PDB:2pe4A	0.041	0.062	3.063	417	0.006	0.010	2pe4A.pdb.gz
17	PDB:6zr2d	0.073	0.220	3.063	120	0.014	0.075	6zr2d.pdb.gz	Structure of inhibitor-bound mammalian complex I.
18	PDB:7pj1B	0.052	0.183	3.267	122	0.035	0.180	7pj1B.pdb.gz
19	PDB:4f37A	0.039	0.143	3.484	102	0.013	0.078	4f37A.pdb.gz
20	PDB:7r97A	0.051	0.136	3.717	226	0.008	0.022	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94842	0.0	1254	621	1.000	1.000	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
2	B7SBD2	3.07e-84	276	577	0.277	0.298	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
3	Q80W03	4.75e-84	276	575	0.277	0.299	TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus OX=10090 GN=Tox3 PE=1 SV=1
4	O15405	4.97e-84	276	576	0.277	0.299	TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=2
5	O94900	3.19e-63	219	526	0.245	0.289	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
6	Q66JW3	1.15e-62	218	526	0.242	0.285	TOX_MOUSE Thymocyte selection-associated high mobility group box protein TOX OS=Mus musculus OX=10090 GN=Tox PE=1 SV=2
7	Q76IQ7	1.19e-47	176	473	0.201	0.264	TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus OX=10116 GN=Tox2 PE=2 SV=1
8	Q96NM4	3.92e-31	129	488	0.169	0.215	TOX2_HUMAN TOX high mobility group box family member 2 OS=Homo sapiens OX=9606 GN=TOX2 PE=1 SV=2
9	H3BTZ9	7.29e-25	103	166	0.108	0.404	H3BTZ9_HUMAN TOX high mobility group box family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=1
10	P11633	1.01e-13	69.3	99	0.055	0.343	NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6B PE=1 SV=3
11	B4UN11	1.58e-13	68.6	93	0.048	0.323	B4UN11_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08541g PE=4 SV=1
12	Q9W602	1.92e-11	69.3	693	0.048	0.043	SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis OX=8355 GN=ssrp1 PE=1 SV=1
13	P07746	2.51e-11	65.5	204	0.048	0.147	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
14	Q08943	2.58e-11	68.9	708	0.056	0.049	SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus OX=10090 GN=Ssrp1 PE=1 SV=2
15	Q9UVL1	2.13e-10	59.7	92	0.043	0.293	NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NHP6 PE=3 SV=1
16	Q08945	2.78e-10	65.9	709	0.050	0.044	SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1
17	Q9Z104	5.42e-10	63.5	317	0.050	0.098	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
18	C9JQA7	5.82e-10	60.1	142	0.053	0.232	C9JQA7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
19	Q6NX86	8.55e-10	61.2	205	0.048	0.146	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
20	Q32L31	1.09e-09	60.8	200	0.052	0.160	HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus OX=9913 GN=HMGB3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	1.7e-14	65.3	HMG (high mobility group) box
2	PF09011 HMG_box_2	2e-08	46.0	HMG-box domain
3	PF04690 YABBY	88	15.1	YABBY protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477868

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296490	0.994	WD repeat-containing protein 82
2	9606.ENSP00000378769	0.985	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
3	9606.ENSP00000365694	0.984	Serine/threonine-protein phosphatase 1 regulatory subunit 10
4	9606.ENSP00000326031	0.981	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
5	9606.ENSP00000341779	0.968	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
6	9606.ENSP00000349124	0.926	Serine/threonine-protein phosphatase 4 regulatory subunit 2
7	9606.ENSP00000221138	0.913	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
8	9606.ENSP00000418447	0.913	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
9	9606.ENSP00000378306	0.912	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
10	9606.ENSP00000378323	0.912	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
11	9606.ENSP00000234310	0.908	Calcineurin subunit B type 1
12	9606.ENSP00000305924	0.908	Serine/threonine-protein phosphatase 4 regulatory subunit 4
13	9606.ENSP00000307786	0.906	Cytochrome c
14	9606.ENSP00000389168	0.905	Protein phosphatase 1 regulatory subunit 12A
15	9606.ENSP00000358464	0.903	Leucine-rich repeat protein SHOC-2
16	9606.ENSP00000412324	0.903	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
17	9606.ENSP00000261461	0.902	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
18	9606.ENSP00000324804	0.902	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
19	9606.ENSP00000325074	0.902	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
20	9606.ENSP00000405635	0.902	CTD nuclear envelope phosphatase 1 regulatory subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.938	heterocyclic compound binding
GO:0097159	0.938	organic cyclic compound binding
GO:0003676	0.933	nucleic acid binding
GO:0003677	0.781	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0009987	0.979	cellular process
GO:0031326	0.970	regulation of cellular biosynthetic process
GO:0019219	0.946	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0051252	0.913	regulation of RNA metabolic process
GO:0006355	0.668	regulation of DNA-templated transcription
GO:0048518	0.649	positive regulation of biological process
GO:0009893	0.580	positive regulation of metabolic process
GO:0010604	0.561	positive regulation of macromolecule metabolic process
GO:0048522	0.524	positive regulation of cellular process
GO:0071704	0.520	organic substance metabolic process
GO:0051173	0.503	positive regulation of nitrogen compound metabolic process
GO:0031325	0.496	positive regulation of cellular metabolic process
GO:0006807	0.378	nitrogen compound metabolic process
GO:0044238	0.374	primary metabolic process
GO:0044237	0.369	cellular metabolic process
GO:0050896	0.342	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0008287	0.990	protein serine/threonine phosphatase complex
GO:0005694	0.989	chromosome
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005654	0.958	nucleoplasm
GO:0000785	0.926	chromatin
GO:0098687	0.914	chromosomal region
GO:0000781	0.881	chromosome, telomeric region
GO:0000164	0.877	protein phosphatase type 1 complex
GO:0072357	0.677	PTW/PP1 phosphatase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]