StarFunc result for job id O94851

User Input

>input (1124 residues)
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDS
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPR
KRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSMAN
QLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATPSPSPPLKRQF
PSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPP
SPPSRLPSPDPAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIG
AAAEVLVNLYMNDHRPKAQATSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGH
FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEA
TWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94851	1.000	1.000	0.000	1124	1.000	1.000	O94851.pdb.gz	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
2	AFDB:Q8BML1	0.546	0.630	0.000	960	0.692	0.810	Q8BML1.pdb.gz	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
3	AFDB:F1RA39	0.443	0.354	3.785E-102	1413	0.516	0.410	F1RA39.pdb.gz	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
4	AFDB:Q7RTP6	0.428	0.240	1.497E-97	2002	0.496	0.279	Q7RTP6.pdb.gz	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
5	AFDB:Q8TDZ2	0.425	0.447	1.372E-79	1067	0.338	0.356	Q8TDZ2.pdb.gz	MICA1_HUMAN [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1 PE=1 SV=2
6	AFDB:Q8VDP3	0.427	0.458	5.530E-79	1048	0.337	0.362	Q8VDP3.pdb.gz	MICA1_MOUSE [F-actin]-monooxygenase MICAL1 OS=Mus musculus OX=10090 GN=Mical1 PE=1 SV=1
7	PDB:3ihgA	0.228	0.450	4.190E-11	535	0.069	0.144	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
8	PDB:2dkiA	0.214	0.364	4.279E-10	615	0.048	0.088	2dkiA.pdb.gz	Crystal structure of 3-hydroxybenzoate hydroxylase from Comamonas testosteroni has a large tunnel for substrate and oxygen access to the active site
9	PDB:7on9A	0.205	0.522	1.725E-9	393	0.051	0.145	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
10	PDB:6lkeA	0.191	0.449	2.352E-9	428	0.049	0.129	6lkeA.pdb.gz	Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition.
11	PDB:5fn0A	0.199	0.440	2.476E-9	455	0.059	0.145	5fn0A.pdb.gz	Kynurenine-3-Monooxygenase Inhibition Prevents Multiple Organ Failure in Rodent Models of Acute Pancreatitis.
12	PDB:1d7lA	0.203	0.506	4.601E-9	394	0.051	0.145	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
13	PDB:5wgrA	0.204	0.322	6.605E-9	664	0.055	0.093	5wgrA.pdb.gz	Function and Structure of MalA/MalA', Iterative Halogenases for Late-Stage C-H Functionalization of Indole Alkaloids.
14	PDB:5dbjE	0.224	0.532	2.166E-8	437	0.055	0.142	5dbjE.pdb.gz	Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
15	PDB:4k22A	0.194	0.534	3.822E-8	354	0.057	0.181	4k22A.pdb.gz
16	PDB:3c96A	0.189	0.489	4.699E-8	381	0.054	0.160	3c96A.pdb.gz	Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa.
17	AFDB:Q8N3D4	0.096	0.072	3.079E-6	1523	0.074	0.054	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
18	AFDB:F1LR12	0.084	0.043	1.255E-2	2425	0.078	0.036	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
19	AFDB:Q9UGP4	0.055	0.091	1.802E-2	676	0.088	0.146	Q9UGP4.pdb.gz	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
20	AFDB:P36166	0.049	0.077	6.899E-2	706	0.074	0.118	P36166.pdb.gz	PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PXL1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RA39	0.0	1256	1679	0.581	0.389	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
2	O94851	0.0	2336	1957	0.988	0.568	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2
3	Q7RTP6	0.0	1045	2002	0.454	0.255	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
4	Q86BA1	0.0	668	4723	0.297	0.071	MICAL_DROME [F-actin]-monooxygenase Mical OS=Drosophila melanogaster OX=7227 GN=Mical PE=1 SV=1
5	Q8BML1	0.0	1937	1951	0.855	0.493	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
6	Q8TDZ2	0.0	637	1067	0.291	0.306	MICA1_HUMAN [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1 PE=1 SV=2
7	Q8VDP3	0.0	622	1048	0.294	0.315	MICA1_MOUSE [F-actin]-monooxygenase MICAL1 OS=Mus musculus OX=10090 GN=Mical1 PE=1 SV=1
8	E1BBG2	5.46e-29	127	853	0.051	0.067	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
9	F1QAZ3	4.92e-28	124	783	0.045	0.065	F1QAZ3_DANRE Mical-like 2b OS=Danio rerio OX=7955 GN=MICAL-2 PE=1 SV=2
10	D3ZEN0	5.45e-28	124	1014	0.045	0.050	MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus OX=10116 GN=Micall2 PE=1 SV=2
11	Q3TN34	7.76e-28	124	1009	0.045	0.051	MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus OX=10090 GN=Micall2 PE=1 SV=1
12	Q8IY33	7.78e-28	124	904	0.057	0.071	MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1
13	Q8N3F8	1.09e-27	123	863	0.051	0.066	MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2
14	D3ZQL6	2.12e-26	119	855	0.044	0.058	MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus OX=10116 GN=Micall1 PE=1 SV=1
15	Q8BGT6	2.37e-26	119	870	0.044	0.057	MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus OX=10090 GN=Micall1 PE=1 SV=3
16	P05095	9.02e-26	117	861	0.050	0.065	ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum OX=44689 GN=abpA PE=1 SV=2
17	Q2YDR5	3.27e-23	108	895	0.053	0.067	Q2YDR5_DANRE Actinin, alpha 2 OS=Danio rerio OX=7955 GN=actn2 PE=1 SV=1
18	P15508	8.96e-23	108	2128	0.048	0.025	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4
19	B2R8Y4	4.13e-22	105	901	0.051	0.063	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
20	P11277	4.19e-22	106	2137	0.047	0.025	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	3.6e+02	11.9	Alanine dehydrogenase/PNT, C-terminal domain
2	PF11971 CAMSAP_CH	7.7e-10	49.8	CAMSAP CH domain
3	PF00307 CH	2.3e-20	84.2	Calponin homology (CH) domain
4	PF01266 DAO	0.36	22.0	FAD dependent oxidoreductase
5	PF00890 FAD_binding_2	0.14	22.9	FAD binding domain
6	PF01494 FAD_binding_3	0.00067	30.6	FAD binding domain
7	PF12831 FAD_oxidored	17	16.2	FAD dependent oxidoreductase
8	PF01134 GIDA	6.1e+02	10.9	Glucose inhibited division protein A
9	PF03486 HI0933_like	4.3	17.6	HI0933-like protein
10	PF00412 LIM	0.00044	31.7	LIM domain
11	PF05834 Lycopene_cycl	51	14.4	Lycopene cyclase protein
12	PF13241 NAD_binding_7	0.35	22.7	Putative NAD(P)-binding
13	PF13450 NAD_binding_8	4	19.1	NAD(P)-binding Rossmann-like domain
14	PF00070 Pyr_redox	1.1	21.1	Pyridine nucleotide-disulphide oxidoreductase
15	PF07992 Pyr_redox_2	0.032	25.1	Pyridine nucleotide-disulphide oxidoreductase
16	PF13738 Pyr_redox_3	0.13	23.1	Pyridine nucleotide-disulphide oxidoreductase
17	PF01946 Thi4	1e+02	13.6	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352882	0.881	Plexin-A4
2	9606.ENSP00000256186	0.877	MICAL C-terminal-like protein
3	9606.ENSP00000416015	0.725	[F-actin]-monooxygenase MICAL3
4	9606.ENSP00000215957	0.703	MICAL-like protein 1
5	9606.ENSP00000297508	0.678	MICAL-like protein 2
6	9606.ENSP00000401437	0.630	LIM domain-binding protein 3
7	9606.ENSP00000382356	0.624	Collagen alpha-1(XXVIII) chain
8	9606.ENSP00000339324	0.618	Small integral membrane protein 15
9	9606.ENSP00000253754	0.608	PDZ and LIM domain protein 4
10	9606.ENSP00000284770	0.608	PDZ and LIM domain protein 3
11	9606.ENSP00000312634	0.608	PDZ and LIM domain protein 2
12	9606.ENSP00000348099	0.608	PDZ and LIM domain protein 7
13	9606.ENSP00000360305	0.608	PDZ and LIM domain protein 1
14	9606.ENSP00000480359	0.608	PDZ and LIM domain protein 5
15	9606.ENSP00000343690	0.603	Dihydropyrimidinase-related protein 3
16	9606.ENSP00000263991	0.598	EH domain-binding protein 1
17	9606.ENSP00000354251	0.597	Nck-associated protein 1
18	9606.ENSP00000282397	0.589	Vascular endothelial growth factor receptor 1
19	9606.ENSP00000367059	0.587	Espin
20	9606.ENSP00000265944	0.576	Myosin-IIIa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	0.998	oxidoreductase activity
GO:0003779	0.998	actin binding
GO:0016709	0.414	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.975	cellular component organization
GO:0043933	0.968	protein-containing complex organization
GO:0022411	0.963	cellular component disassembly
GO:0006996	0.961	organelle organization
GO:0050794	0.955	regulation of cellular process
GO:0051261	0.950	protein depolymerization
GO:0008154	0.950	actin polymerization or depolymerization
GO:0030042	0.899	actin filament depolymerization
GO:0048518	0.826	positive regulation of biological process
GO:0019222	0.810	regulation of metabolic process
GO:0060255	0.779	regulation of macromolecule metabolic process
GO:0031323	0.768	regulation of cellular metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0051171	0.743	regulation of nitrogen compound metabolic process
GO:0048522	0.666	positive regulation of cellular process
GO:0009889	0.635	regulation of biosynthetic process
GO:0010556	0.626	regulation of macromolecule biosynthetic process
GO:0009893	0.586	positive regulation of metabolic process
GO:0031326	0.578	regulation of cellular biosynthetic process
GO:0019219	0.576	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.549	regulation of gene expression
GO:1903506	0.507	regulation of nucleic acid-templated transcription
GO:0009891	0.435	positive regulation of biosynthetic process
GO:0006355	0.430	regulation of DNA-templated transcription
GO:0010604	0.407	positive regulation of macromolecule metabolic process
GO:0031325	0.403	positive regulation of cellular metabolic process
GO:0051173	0.326	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.993	nucleus
GO:0005737	0.963	cytoplasm
GO:0016020	0.548	membrane
GO:0005829	0.514	cytosol
GO:0071944	0.433	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.998	Oxidoreductases.
EC:1.14.13.-	0.414	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]