StarFunc result for job id O94854

User Input

>input (1291 residues)
MPPNFPEFAERIEASLSEVSEAGASNPSLQEKKESSSALTESSGHLDHREPQSESVTLEH
VSKSIGIPEVQDFKNLSGDCQDFRFQQHSANPPHEFQPVESEAVATSGNTDVMQESRFSS
ATWPRATKSLAKGGFSEKQHPLGDTACTVEMPPLSPCLSEELLDPELHVLITPSLREKTE
SELKFEEDERWIMMEAEGEWEEEKLSDREKTFLMADEKNSLADIFEEREQANTAVVEDGS
DCLAAVLRTFGHLSLGQICCPDDPQPAKDQLATVPKDIPLDCDCVLTGEDILGEVANRTA
QGLEGLVSDSACTVGTIDAEQLSDTDSVQMFLELEKECLCEEGVTPLVELQNQISSEGLA
ASQDAENLLVISHFSGAALEKEQHLGLLHVRAKDYDTRLDCGYFNTLDSSQVPNAVELIA
HVDIMRDTSTVSKEECEKVPFSPRTAEFKSRQPADLDSLEKLDPGGLLNSDHRVSHEEKL
SGFIASELAKDNGSLSQGDCSQTEGNGEECIERVTFSFAFNHELTDVTSGPEVEVLYESN
LLTDEIHLESGNVTVNQENNSLTSMGNVVTCELSVEKVCDEDGEAKELDYQATLLEDQAP
AHFHRNFPEQVFQDLQRKSPESEILSLHLLVEELRLNPDGVETVNDTKPELNVASSEGGE
MERRDSDSFLNIFPEKQVTKAGNTEPVLEEWIPVLQRPSRTAAVPTVKDALDAALPSPEE
GTSIAAVPAPEGTAVVAALVPFPHEDILVASIVSLEEEDVTAAAVSAPERATVPAVTVSV
PEGTAAVAAVSSPEETAPAVAAAITQEGMSAVAGFSPEWAALAITVPITEEDGTPEGPVT
PATTVHAPEEPDTAAVRVSTPEEPASPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPP
EEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAA
AVPTPEEPTSPAAAVPTPEEPASPAAAVPTPEEPASPAAAVPTPEEPAFPAPAVPTPEES
ASAAVAVPTPEESASPAAAVPTPAESASFAAVVATLEEPTSPAASVPTPAAMVATLEEFT
SPAASVPTSEEPASLAAAVSNPEEPTSPAAAVPTLEEPTSSAAAVLTPEELSSPAASVPT
PEEPASPAAAVSNLEEPASPAAAVPTPEVAAIPAASVPTPEVPAIPAAAVPPMEEVSPIG
VPFLGVSAHTDSVPISEEGTPVLEEASSTGMWIKEDLDSLVFGIKEVTSTVLHGKVPLAA
TAGLNSDEVIVHFDSGKGLKSKVRFAGLTWW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZZ9	0.106	0.130	4.845E-72	979	0.490	0.646	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
2	AFDB:Q9NZ56	0.042	0.033	2.154E-9	1722	0.179	0.134	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	AFDB:O42854	0.038	0.032	7.433E-7	1611	0.177	0.142	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
4	AFDB:P23226	0.035	0.037	4.706E-6	1185	0.167	0.182	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
5	AFDB:G3V9G5	0.040	0.036	1.015E-5	1557	0.136	0.112	G3V9G5.pdb.gz	G3V9G5_RAT Synemin OS=Rattus norvegicus OX=10116 GN=Synm PE=1 SV=2
6	AFDB:A6NGG8	0.037	0.037	1.096E-5	1288	0.165	0.165	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
7	AFDB:Q9SD86	0.044	0.039	2.365E-5	1501	0.150	0.129	Q9SD86.pdb.gz	Q9SD86_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=F13G24.180 PE=1 SV=1
8	AFDB:Q3UG20	0.037	0.030	3.474E-5	1868	0.162	0.112	Q3UG20.pdb.gz	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
9	AFDB:Q09904	0.036	0.038	5.952E-5	1159	0.151	0.168	Q09904.pdb.gz	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
10	AFDB:O15061	0.052	0.044	6.941E-5	1565	0.119	0.098	O15061.pdb.gz	SYNEM_HUMAN Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=3
11	PDB:6edtJ	0.020	0.184	1.367	109	0.007	0.083	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:7k50g	0.016	0.140	1.722	125	0.004	0.040	7k50g.pdb.gz	Structural basis for +1 ribosomal frameshifting during EF-G-catalyzed translocation.
13	PDB:6hndB	0.018	0.045	2.530	470	0.009	0.026	6hndB.pdb.gz	Crystal structures of aminotransferases Aro8 and Aro9 from Candida albicans and structural insights into their properties.
14	PDB:5xqmA	0.022	0.219	2.950	90	0.005	0.067	5xqmA.pdb.gz
15	PDB:5kynA	0.016	0.028	3.441	730	0.004	0.007	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
16	PDB:3cphA	0.021	0.119	3.716	175	0.005	0.040	3cphA.pdb.gz	A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
17	PDB:5mrc66	0.017	0.063	4.680	305	0.002	0.010	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:2m01A	0.018	0.227	5.458	59	0.003	0.068	2m01A.pdb.gz
19	PDB:7ksoC	0.021	0.054	5.458	420	0.005	0.014	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
20	PDB:1wz0A	0.018	0.179	6.365	104	0.003	0.038	1wz0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YYJ5	0.0	2482	1668	0.982	0.760	A0A0A6YYJ5_HUMAN Microtubule actin crosslinking factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=2
2	Q69ZZ9	0.0	934	3305	0.452	0.177	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
3	M9PCJ6	1.61e-18	95.1	18641	0.083	0.006	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
4	M9PC48	1.63e-18	95.1	18095	0.083	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	Q57X74	6.87e-10	65.9	574	0.112	0.253	Q57X74_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.670 PE=4 SV=1
6	Q8IIK5	2.07e-06	55.1	1201	0.049	0.052	Q8IIK5_PLAF7 Rhoptry neck protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116000 PE=4 SV=2
7	A0A8I6GLH8	6.16e-06	53.1	1110	0.070	0.081	A0A8I6GLH8_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
8	A0A8I5ZUA1	8.90e-06	52.8	1053	0.068	0.084	A0A8I5ZUA1_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
9	A0A8I5ZQX0	1.25e-05	52.4	1065	0.070	0.085	A0A8I5ZQX0_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
10	P19246	1.80e-05	51.6	1090	0.102	0.121	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
11	Q389F6	1.86e-05	51.2	405	0.077	0.244	Q389F6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1920 PE=4 SV=1
12	Q8CHD8	2.22e-05	51.6	1047	0.075	0.093	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2
13	P16884	4.70e-05	50.4	1072	0.121	0.146	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
14	Q9JKS6	1.35e-04	49.3	5085	0.049	0.012	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
15	O01761	1.38e-04	49.3	8081	0.074	0.012	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
16	D3ZQU7	0.002	44.7	717	0.034	0.061	D3ZQU7_RAT Glycoprotein Ib platelet subunit alpha OS=Rattus norvegicus OX=10116 GN=Gp1ba PE=1 SV=1
17	Q95TJ2	0.002	45.1	1261	0.046	0.047	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
18	A0A8I5ZUN3	0.006	43.9	35375	0.105	0.004	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q9PU53	0.009	42.7	718	0.045	0.081	TERF2_CHICK Telomeric repeat-binding factor 2 OS=Gallus gallus OX=9031 GN=TERF2 PE=1 SV=2
20	P12036	0.012	42.7	1026	0.086	0.108	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 72004.XP_005907838.1

Rank	PPI partner	STRING score	Description
1	72004.XP_005898503.1	0.836	Belongs to the peptidase S1 family.
2	72004.XP_005904212.1	0.714	Belongs to the peptidase C14A family.
3	72004.XP_005909637.1	0.631	Loricrin
4	72004.XP_005895046.1	0.615	Involucrin
5	72004.XP_005890216.1	0.578	Collagen alpha-4(IV) chain
6	72004.XP_005904704.1	0.578	Collagen alpha-2(IV) chain
7	72004.XP_005904705.1	0.578	Collagen alpha-1(IV) chain
8	72004.XP_005910899.1	0.578	Collagen alpha-5(IV) chain isoform X1
9	72004.XP_005910901.1	0.578	Collagen type IV alpha 6 chain
10	72004.XP_005907074.1	0.573	Keratin, type II cytoskeletal 1
11	72004.XP_005895042.1	0.540	Cornulin
12	72004.XP_005909442.1	0.530	Collagen alpha-1(VII) chain
13	72004.XP_005889601.1	0.529	Collagen alpha-2(V) chain
14	72004.XP_005889602.1	0.529	Collagen alpha-1(III) chain-like
15	72004.XP_005890387.1	0.529	Collagen alpha-1(I) chain-like
16	72004.XP_005891447.1	0.529	Collagen alpha-2(XI) chain isoform X1
17	72004.XP_005897513.1	0.529	Collagen type V alpha 1 chain
18	72004.XP_005898014.1	0.529	Collagen type XI alpha 1 chain
19	72004.XP_005905523.1	0.529	Collagen type II alpha 1 chain
20	72004.XP_005886859.1	0.515	Belongs to the peptidase S1 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.994	cytoskeletal protein binding
GO:0015631	0.968	tubulin binding
GO:0008017	0.959	microtubule binding
GO:0003779	0.931	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.977	anatomical structure development
GO:0009987	0.963	cellular process
GO:0007275	0.936	multicellular organism development
GO:0050789	0.915	regulation of biological process
GO:0050794	0.899	regulation of cellular process
GO:0009888	0.847	tissue development
GO:0009653	0.661	anatomical structure morphogenesis
GO:0048513	0.451	animal organ development
GO:0048731	0.442	system development
GO:0071840	0.431	cellular component organization or biogenesis
GO:0016043	0.387	cellular component organization
GO:0050896	0.314	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.999	cytoskeleton
GO:0005737	0.981	cytoplasm
GO:0016020	0.977	membrane
GO:0005886	0.956	plasma membrane
GO:0030054	0.879	cell junction
GO:0015629	0.877	actin cytoskeleton
GO:0005829	0.499	cytosol
GO:0005815	0.380	microtubule organizing center
GO:0099081	0.354	supramolecular polymer
GO:0099512	0.314	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]