StarFunc result for job id O94855

User Input

>input (1032 residues)
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPG
PPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQANSGPQMAGAQLSYPG
GFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCM
IQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEET
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
DQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYK
YNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAA
IDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSC
ETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMK
VLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKST
MLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLP
EVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFL
CCVHKEICQLLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QRB4	0.760	0.762	0.000	1030	0.656	0.657	F1QRB4.pdb.gz	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
2	AFDB:G3X972	0.759	0.715	0.000	1096	0.581	0.547	G3X972.pdb.gz	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
3	AFDB:O94855	1.000	1.000	0.000	1032	1.000	1.000	O94855.pdb.gz	SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2
4	AFDB:Q6NXL1	0.836	0.836	0.000	1032	0.882	0.882	Q6NXL1.pdb.gz	Q6NXL1_MOUSE Sec24 related gene family, member D (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24d PE=1 SV=1
5	AFDB:Q80U83	0.755	0.757	0.000	1028	0.554	0.556	Q80U83.pdb.gz	Q80U83_MOUSE MKIAA0079 protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
6	AFDB:Q9M291	0.733	0.691	1.893E-86	1096	0.330	0.311	Q9M291.pdb.gz	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
7	AFDB:Q9SFU0	0.686	0.682	9.769E-80	1038	0.297	0.296	Q9SFU0.pdb.gz	SC24A_ARATH Protein transport protein SEC24 A OS=Arabidopsis thaliana OX=3702 GN=SEC24A PE=1 SV=2
8	AFDB:O95487	0.667	0.546	6.886E-75	1268	0.280	0.228	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
9	AFDB:D3ZW15	0.665	0.556	4.068E-73	1242	0.275	0.229	D3ZW15.pdb.gz	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
10	AFDB:O95486	0.653	0.618	5.348E-72	1093	0.260	0.245	O95486.pdb.gz	SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2
11	PDB:6zgaB	0.640	0.833	8.209E-57	786	0.198	0.260	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
12	PDB:1m2vA	0.536	0.765	1.004E-38	705	0.121	0.177	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
13	PDB:5kynA	0.545	0.751	6.223E-38	730	0.127	0.179	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
14	PDB:6zgaA	0.540	0.724	5.767E-32	751	0.121	0.166	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
15	PDB:6ujaB	0.152	0.346	2.499E-7	359	0.040	0.114	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
16	PDB:1u8cB	0.137	0.210	7.714E-7	599	0.046	0.078	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
17	PDB:4g1eB	0.147	0.200	1.065E-6	709	0.041	0.059	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
18	PDB:7nxdB	0.154	0.214	2.139E-6	690	0.045	0.067	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
19	PDB:7ad8D	0.147	0.495	1.070E-5	280	0.039	0.143	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
20	PDB:6jp8F	0.140	0.147	1.191E-5	973	0.034	0.036	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YDI8	0.0	1117	1020	0.563	0.570	A0A286YDI8_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
2	D5LMH4	0.0	1275	1029	0.642	0.644	D5LMH4_DANRE Protein transport protein Sec24D OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=1
3	E9PDM8	0.0	1384	663	0.642	1.000	E9PDM8_HUMAN SEC24 homolog D, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=1
4	F1QRB4	0.0	1300	1030	0.645	0.647	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
5	G3X972	0.0	1132	1096	0.587	0.553	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
6	M9PC99	0.0	834	1231	0.379	0.318	M9PC99_DROME Secretory 24CD, isoform C OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=1
7	O94855	0.0	2121	1032	1.000	1.000	SC24D_HUMAN Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2
8	P53992	0.0	1138	1094	0.576	0.543	SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3
9	Q3V222	0.0	1113	803	0.499	0.641	Q3V222_MOUSE Sec24c protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
10	Q6NXL1	0.0	1765	1032	0.882	0.882	Q6NXL1_MOUSE Sec24 related gene family, member D (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24d PE=1 SV=1
11	Q80U83	0.0	1117	1028	0.563	0.565	Q80U83_MOUSE MKIAA0079 protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
12	Q80V21	0.0	999	524	0.467	0.920	Q80V21_MOUSE Sec24d protein OS=Mus musculus OX=10090 GN=Sec24d PE=2 SV=1
13	Q8CGF4	0.0	1132	1096	0.587	0.553	Q8CGF4_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
14	Q8R0M3	0.0	819	434	0.383	0.910	Q8R0M3_MOUSE Sec24d protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24d PE=2 SV=1
15	Q8R2V9	0.0	567	436	0.254	0.601	Q8R2V9_MOUSE Sec24c protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
16	Q9VQ94	0.0	833	1193	0.379	0.328	Q9VQ94_DROME LP05220p OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=2
17	Q9M291	1.42e-157	496	1096	0.289	0.272	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
18	Q9SFU0	1.77e-137	442	1038	0.231	0.229	SC24A_ARATH Protein transport protein SEC24 A OS=Arabidopsis thaliana OX=3702 GN=SEC24A PE=1 SV=2
19	Q9USS7	8.15e-126	407	891	0.248	0.287	YNB3_SCHPO Uncharacterized protein C4.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.03c PE=2 SV=1
20	O95487	2.98e-115	387	1268	0.220	0.179	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16363 GDP_Man_Dehyd	4.4e+02	11.7	GDP-mannose 4,6 dehydratase
2	PF00626 Gelsolin	4.8e-06	37.7	Gelsolin repeat
3	PF08033 Sec23_BS	1.9e-14	65.5	Sec23/Sec24 beta-sandwich domain
4	PF04815 Sec23_helical	4.4e-20	82.8	Sec23/Sec24 helical domain
5	PF04811 Sec23_trunk	4.4e-85	296.7	Sec23/Sec24 trunk domain
6	PF04236 Transp_Tc5_C	9.6e+02	11.6	Tc5 transposase C-terminal domain
7	PF04810 zf-Sec23_Sec24	4.4e-10	50.7	Sec23/Sec24 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306881	0.999	Protein transport protein Sec23A
2	9606.ENSP00000381823	0.996	Protein transport protein Sec24A
3	9606.ENSP00000338844	0.994	Protein transport protein Sec23B
4	9606.ENSP00000373312	0.994	Protein SEC13 homolog
5	9606.ENSP00000378721	0.994	Protein transport protein Sec31A
6	9606.ENSP00000343405	0.987	Protein transport protein Sec24C
7	9606.ENSP00000362339	0.985	GTP-binding protein SAR1a
8	9606.ENSP00000325827	0.981	Protein transport protein Sec16A
9	9606.ENSP00000356230	0.974	Kelch-like protein 12
10	9606.ENSP00000222547	0.968	BET1 homolog
11	9606.ENSP00000428564	0.967	Protein transport protein Sec24B
12	9606.ENSP00000359370	0.957	Protein transport protein Sec31B
13	9606.ENSP00000390783	0.952	Sec1 family domain-containing protein 1
14	9606.ENSP00000259400	0.949	Syntaxin-17
15	9606.ENSP00000362807	0.944	Peflin
16	9606.ENSP00000385432	0.942	GTP-binding protein SAR1b
17	9606.ENSP00000294179	0.937	Syntaxin-5
18	9606.ENSP00000260643	0.922	Prolactin regulatory element-binding protein
19	9606.ENSP00000405926	0.913	Transmembrane emp24 domain-containing protein 7
20	9606.ENSP00000225567	0.911	Golgi SNAP receptor complex member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000149	1.000	SNARE binding
GO:0008270	0.999	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0051179	0.985	localization
GO:0006810	0.971	transport
GO:0016043	0.967	cellular component organization
GO:0016050	0.809	vesicle organization
GO:0048193	0.761	Golgi vesicle transport
GO:0061024	0.737	membrane organization
GO:0006900	0.731	vesicle budding from membrane
GO:0051641	0.600	cellular localization
GO:0051649	0.570	establishment of localization in cell
GO:0046907	0.552	intracellular transport
GO:0006888	0.542	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0032501	0.517	multicellular organismal process
GO:0032502	0.428	developmental process
GO:0048856	0.423	anatomical structure development
GO:0007275	0.414	multicellular organism development
GO:0065007	0.340	biological regulation
GO:0050789	0.326	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0012507	0.999	ER to Golgi transport vesicle membrane
GO:0098796	0.996	membrane protein complex
GO:0031984	0.995	organelle subcompartment
GO:0005789	0.993	endoplasmic reticulum membrane
GO:0005829	0.989	cytosol
GO:0030120	0.985	vesicle coat
GO:0030127	0.983	COPII vesicle coat

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]