StarFunc result for job id O94856

User Input

>input (1347 residues)
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITD
YVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFP
YSNYKLEMVVVNGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNG
IMIGYTLKYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVT
EESPAPPNEATPTAAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPTTIAT
TTTVATTTTTTAAATTTTESPPTTTSGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNF
GPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFM
TSTAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPED
PKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYT
VKKDKEETEGNESSEATSPVNAIYSLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00533	0.324	0.357	0.000	1208	0.354	0.395	O00533.pdb.gz	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
2	AFDB:O94856	0.999	0.999	0.000	1347	1.000	1.000	O94856.pdb.gz	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
3	AFDB:P32004	0.307	0.327	0.000	1257	0.353	0.378	P32004.pdb.gz	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
4	AFDB:P35331	0.344	0.360	0.000	1284	0.463	0.485	P35331.pdb.gz	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
5	AFDB:P97685	0.329	0.356	0.000	1240	0.883	0.959	P97685.pdb.gz	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
6	AFDB:P97686	0.357	0.392	0.000	1214	0.450	0.499	P97686.pdb.gz	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
7	AFDB:Q810U4	0.373	0.392	0.000	1256	0.460	0.494	Q810U4.pdb.gz	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
8	AFDB:Q92823	0.386	0.398	0.000	1304	0.474	0.490	Q92823.pdb.gz	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
9	AFDB:M0RC17	0.331	0.366	1.418E-101	1210	0.330	0.367	M0RC17.pdb.gz	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
10	AFDB:G5ECX2	0.281	0.316	4.656E-88	1187	0.232	0.264	G5ECX2.pdb.gz	G5ECX2_CAEEL Immunoglobulin domain-containing protein Y54G2A.25 OS=Caenorhabditis elegans OX=6239 GN=lad-2 PE=2 SV=1
11	PDB:5oj2B	0.126	0.223	7.117E-28	692	0.110	0.214	5oj2B.pdb.gz
12	PDB:1e07A	0.111	0.210	4.851E-20	642	0.082	0.173	1e07A.pdb.gz
13	PDB:7sqcO0	0.102	0.118	6.078E-17	1140	0.075	0.089	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.097	0.086	4.487E-16	1597	0.091	0.076	5a42A.pdb.gz
15	PDB:7q1yA	0.081	0.080	6.549E-15	1374	0.065	0.064	7q1yA.pdb.gz
16	PDB:6dldD	0.112	0.446	1.484E-14	269	0.045	0.227	6dldD.pdb.gz
17	PDB:7q5zA	0.099	0.099	3.114E-13	1344	0.059	0.059	7q5zA.pdb.gz
18	PDB:8dtlA	0.124	0.201	9.698E-13	741	0.039	0.070	8dtlA.pdb.gz
19	PDB:6pxvA	0.126	0.189	1.528E-12	823	0.036	0.058	6pxvA.pdb.gz
20	PDB:6pyhD	0.106	0.161	1.917E-12	798	0.047	0.079	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y8T8	0.0	692	1209	0.287	0.319	A0A8I5Y8T8_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
2	A0A8I5YCG7	0.0	643	1177	0.273	0.313	A0A8I5YCG7_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
3	A0A8I6A9A6	0.0	683	1170	0.287	0.330	A0A8I6A9A6_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
4	M0RC17	0.0	684	1224	0.287	0.315	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
5	O00533	0.0	690	1208	0.290	0.324	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
6	O94856	0.0	2793	1347	1.000	1.000	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
7	P11627	0.0	703	1260	0.287	0.306	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
8	P32004	0.0	717	1257	0.287	0.308	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
9	P35331	0.0	1050	1284	0.377	0.396	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
10	P70232	0.0	678	1209	0.282	0.314	NCHL1_MOUSE Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
11	P97685	0.0	1714	1240	0.617	0.670	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
12	P97686	0.0	1003	1214	0.376	0.417	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
13	Q03696	0.0	582	1266	0.266	0.283	NGCA_CHICK Neuronal-glial cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=2
14	Q05695	0.0	701	1259	0.287	0.307	L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus norvegicus OX=10116 GN=L1cam PE=1 SV=3
15	Q810U3	0.0	1707	1240	0.601	0.653	NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=Nfasc PE=1 SV=1
16	Q810U4	0.0	1001	1256	0.375	0.402	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
17	Q90933	0.0	652	1280	0.278	0.292	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q92823	0.0	1018	1304	0.385	0.397	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
19	Q90478	7.05e-172	546	1197	0.252	0.283	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
20	P20241	1.06e-149	489	1302	0.245	0.253	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	92	14.2	Adenovirus E3 region protein CR1
2	PF06832 BiPBP_C	2.4	19.6	Penicillin-Binding Protein C-terminus Family
3	PF13882 Bravo_FIGEY	1.1e-24	98.7	Bravo-like intracellular region
4	PF07654 C1-set	2.9e+02	13.2	Immunoglobulin C1-set domain
5	PF08205 C2-set_2	4.8e-05	34.6	CD80-like C2-set immunoglobulin domain
6	PF16389 DUF4998	1.3e+02	13.6	Domain of unknown function
7	PF00041 fn3	1.1e-42	155.5	Fibronectin type III domain
8	PF07679 I-set	6.3e-70	242.6	Immunoglobulin I-set domain
9	PF00047 ig	5e-39	143.7	Immunoglobulin domain
10	PF13895 Ig_2	1.1e-45	165.1	Immunoglobulin domain
11	PF13927 Ig_3	8.8e-73	252.2	Immunoglobulin domain
12	PF16680 Ig_4	0.00039	32.3	T-cell surface glycoprotein CD3 delta chain
13	PF16681 Ig_5	4.2e-07	41.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
14	PF18452 Ig_6	0.0027	29.0	Immunoglobulin domain
15	PF16706 Izumo-Ig	5.4	18.3	Izumo-like Immunoglobulin domain
16	PF11465 Receptor_2B4	35	16.0	Natural killer cell receptor 2B4
17	PF07686 V-set	7.6e-15	66.4	Immunoglobulin V-set domain
18	PF08204 V-set_CD47	0.69	21.3	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008974812.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813950.1	0.978	Contactin-associated protein 1 isoform X1
2	9597.XP_003825775.1	0.894	Contactin-1 isoform X1
3	9597.XP_003821230.1	0.860	Ankyrin 3
4	9597.XP_008975172.1	0.822	Ankyrin-1 isoform X1
5	9597.XP_008953651.1	0.818	Ankyrin-2 isoform X1
6	9597.XP_008973801.1	0.802	Doublecortin
7	9597.XP_008972905.1	0.798	Ankyrin-2-like
8	9597.XP_003822028.1	0.795	Syndecan binding protein
9	9597.XP_003827883.2	0.780	Gliomedin isoform X1
10	9597.XP_008963213.1	0.774	Belongs to the spectrin family.
11	9597.XP_003820562.1	0.739	Contactin-associated protein-like 2
12	9597.XP_008960521.1	0.699	Belongs to the potassium channel family.
13	9597.XP_008954714.1	0.691	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
14	9597.XP_003820970.1	0.664	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
15	9597.XP_003808684.1	0.623	Receptor-type tyrosine-protein phosphatase zeta isoform X1
16	9597.XP_003829950.1	0.619	Atonal bHLH transcription factor 1
17	9597.XP_003820009.1	0.615	Sodium voltage-gated channel beta subunit 3
18	9597.XP_003820378.1	0.602	Potassium voltage-gated channel subfamily A member 1
19	9597.XP_003810710.1	0.599	Potassium voltage-gated channel subfamily A member 2
20	9597.XP_003830884.1	0.592	Belongs to the spectrin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.447	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007275	0.995	multicellular organism development
GO:0071840	0.992	cellular component organization or biogenesis
GO:0007399	0.990	nervous system development
GO:0030154	0.986	cell differentiation
GO:0050896	0.985	response to stimulus
GO:0048468	0.980	cell development
GO:0016043	0.977	cellular component organization
GO:0031175	0.969	neuron projection development
GO:0061564	0.951	axon development
GO:0050789	0.899	regulation of biological process
GO:0050794	0.882	regulation of cellular process
GO:0051179	0.868	localization
GO:0009653	0.828	anatomical structure morphogenesis
GO:0032989	0.704	cellular component morphogenesis
GO:0007154	0.692	cell communication
GO:0000902	0.650	cell morphogenesis
GO:0048812	0.643	neuron projection morphogenesis
GO:0051716	0.620	cellular response to stimulus
GO:0007409	0.557	axonogenesis
GO:0040011	0.482	locomotion
GO:0042221	0.474	response to chemical
GO:0033036	0.436	macromolecule localization
GO:0051641	0.426	cellular localization
GO:0070727	0.410	cellular macromolecule localization
GO:0008104	0.393	protein localization
GO:0048518	0.388	positive regulation of biological process
GO:0050877	0.362	nervous system process
GO:0022607	0.346	cellular component assembly
GO:0006810	0.339	transport
GO:0007272	0.303	ensheathment of neurons
GO:0065008	0.300	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030424	0.998	axon
GO:0033268	0.993	node of Ranvier
GO:0030054	0.949	cell junction
GO:0045202	0.868	synapse
GO:0070161	0.860	anchoring junction
GO:0043194	0.854	axon initial segment
GO:0043226	0.842	organelle
GO:0005911	0.820	cell-cell junction
GO:0005622	0.591	intracellular anatomical structure
GO:0005737	0.533	cytoplasm
GO:0036477	0.510	somatodendritic compartment
GO:0043229	0.509	intracellular organelle
GO:0043227	0.462	membrane-bounded organelle
GO:0012505	0.447	endomembrane system
GO:0043231	0.368	intracellular membrane-bounded organelle
GO:0031982	0.365	vesicle
GO:0097060	0.345	synaptic membrane
GO:0098794	0.304	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]