StarFunc result for job id O94868

User Input

>input (740 residues)
MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKL
ASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVR
SLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLF
QSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGN
VYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRDYNLQLFLQENAVFHKPQPFQ
FQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLNDLECHGAAVS
EQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSY
KASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSL
AALDSRSHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKE
NQDDDGFWEGEFNGRIGVFPSVLVEELSASENGDTPWMREIQISPSPKPHASLPPLPLYD
QPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQASRHTPETSYGKLRPVRAAPPP
PTQNHRRPAEKIEDVEITLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94868	1.000	1.000	1.388E-101	740	1.000	1.000	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
2	AFDB:X2JAU8	0.515	0.365	1.949E-45	1075	0.341	0.234	X2JAU8.pdb.gz	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
3	AFDB:M9NF07	0.276	0.319	3.552E-16	623	0.131	0.156	M9NF07.pdb.gz	M9NF07_DROME Cdc42-interacting protein 4, isoform I OS=Drosophila melanogaster OX=7227 GN=Cip4 PE=4 SV=1
4	AFDB:F1LRS8	0.088	0.100	3.408E-8	637	0.096	0.111	F1LRS8.pdb.gz	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
5	PDB:2lqnA	0.082	0.189	7.408E-8	303	0.064	0.155	2lqnA.pdb.gz
6	AFDB:Q9Y5K6	0.085	0.098	1.320E-7	639	0.073	0.085	Q9Y5K6.pdb.gz	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
7	AFDB:P32790	0.078	0.049	5.114E-7	1244	0.076	0.045	P32790.pdb.gz	SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA1 PE=1 SV=1
8	PDB:1griA	0.079	0.268	1.225E-6	211	0.054	0.190	1griA.pdb.gz
9	PDB:2eyzA	0.080	0.189	3.549E-6	304	0.043	0.105	2eyzA.pdb.gz
10	PDB:3hajA	0.209	0.419	3.549E-6	286	0.057	0.147	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
11	PDB:6ikoA	0.274	0.599	7.332E-6	303	0.059	0.145	6ikoA.pdb.gz
12	AFDB:A0A494C1M0	0.085	0.063	1.371E-5	1011	0.050	0.037	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
13	AFDB:Q9JIR0	0.094	0.041	1.586E-5	1847	0.072	0.029	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
14	AFDB:A0A0U1RQE4	0.090	0.064	1.833E-5	1047	0.053	0.037	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
15	AFDB:O95153	0.085	0.040	2.572E-5	1857	0.076	0.030	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
16	PDB:1k9aB	0.083	0.137	2.628E-4	441	0.022	0.036	1k9aB.pdb.gz
17	PDB:3qwyA	0.079	0.332	5.172E-4	170	0.022	0.094	3qwyA.pdb.gz
18	PDB:3ehqA	0.076	0.292	5.698E-4	182	0.031	0.126	3ehqA.pdb.gz
19	PDB:2dybA	0.078	0.191	1.121E-3	298	0.038	0.094	2dybA.pdb.gz
20	PDB:2h8hA	0.072	0.116	3.250E-3	445	0.022	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94868	0.0	1542	740	1.000	1.000	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
2	Q3USJ8	0.0	1497	740	0.965	0.965	FCSD2_MOUSE F-BAR and double SH3 domains protein 2 OS=Mus musculus OX=10090 GN=Fchsd2 PE=1 SV=2
3	Q6PFY1	9.08e-141	431	688	0.336	0.362	FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus OX=10090 GN=Fchsd1 PE=1 SV=1
4	X2JAU8	1.27e-83	289	1075	0.223	0.153	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
5	Q9Z0R4	1.81e-17	90.1	1714	0.078	0.034	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
6	Q15811	1.88e-17	89.7	1721	0.084	0.036	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
7	Q9WVE9	9.04e-17	87.8	1713	0.077	0.033	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
8	F8W7U0	3.10e-16	85.9	1149	0.073	0.047	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
9	B7ZM87	8.54e-16	84.3	1070	0.126	0.087	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
10	D4A208	6.40e-15	81.3	1071	0.127	0.088	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
11	Q91Z67	7.73e-15	81.3	1071	0.127	0.088	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
12	O75044	1.50e-14	80.1	1071	0.126	0.087	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
13	A9P3U3	1.72e-14	79.7	774	0.077	0.074	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
14	A0A286YEY3	1.21e-12	73.2	459	0.124	0.200	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
15	P98171	2.18e-12	73.2	946	0.104	0.081	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
16	Q9NZM3	5.78e-12	72.0	1697	0.069	0.030	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
17	O55033	6.18e-12	70.5	380	0.069	0.134	NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus OX=10090 GN=Nck2 PE=1 SV=1
18	D4A3M8	6.24e-12	70.5	380	0.069	0.134	D4A3M8_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck2 PE=1 SV=1
19	Q95PW9	7.00e-12	70.5	395	0.076	0.142	Q95PW9_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
20	Q95PX0	7.14e-12	70.5	397	0.076	0.141	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20572 DUF6781	20	16.5	Family of unknown function (DUF6781)
2	PF00611 FCH	5.9e-15	66.7	Fes/CIP4, and EFC/F-BAR homology domain
3	PF14603 hSH3	21	17.1	Helically-extended SH3 domain
4	PF00018 SH3_1	1.2e-21	87.3	SH3 domain
5	PF07653 SH3_2	4.6e-15	66.5	Variant SH3 domain
6	PF08239 SH3_3	30	16.4	Bacterial SH3 domain
7	PF14604 SH3_9	4.4e-20	82.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365891	0.903	Wiskott-Aldrich syndrome protein
2	9606.ENSP00000370719	0.898	Intersectin-1
3	9606.ENSP00000273183	0.872	SH3 and cysteine-rich domain-containing protein
4	9606.ENSP00000256649	0.871	Tripartite motif-containing protein 45
5	9606.ENSP00000414147	0.853	Spartin
6	9606.ENSP00000360293	0.842	Sorbin and SH3 domain-containing protein 1
7	9606.ENSP00000223023	0.795	Neural Wiskott-Aldrich syndrome protein
8	9606.ENSP00000379621	0.794	Sorting nexin-16
9	9606.ENSP00000375608	0.739	Killer cell immunoglobulin-like receptor 3DL1
10	9606.ENSP00000336769	0.705	Killer cell immunoglobulin-like receptor 2DL1
11	9606.ENSP00000263666	0.687	E3 ubiquitin-protein ligase PDZRN3
12	9606.ENSP00000285737	0.687	Lon protease homolog 2, peroxisomal
13	9606.ENSP00000367408	0.686	Peripheral plasma membrane protein CASK
14	9606.ENSP00000291860	0.684	Killer cell immunoglobulin-like receptor 3DL3
15	9606.ENSP00000345295	0.684	SH2 domain containing 4B
16	9606.ENSP00000217173	0.683	RING finger protein 37
17	9606.ENSP00000315182	0.682	Protein SHQ1 homolog
18	9606.ENSP00000325525	0.681	Killer cell immunoglobulin-like receptor 3DL2
19	9606.ENSP00000339634	0.681	Killer cell immunoglobulin-like receptor 2DL4
20	9606.ENSP00000402505	0.678	C3 and PZP like, alpha-2-macroglobulin domain containing 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	0.989	phospholipid binding
GO:0043325	0.977	phosphatidylinositol-3,4-bisphosphate binding
GO:0035091	0.896	phosphatidylinositol binding
GO:0005547	0.891	phosphatidylinositol-3,4,5-trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0010638	0.943	positive regulation of organelle organization
GO:0016043	0.937	cellular component organization
GO:1902903	0.887	regulation of supramolecular fiber organization
GO:0032970	0.886	regulation of actin filament-based process
GO:0031334	0.885	positive regulation of protein-containing complex assembly
GO:1902905	0.882	positive regulation of supramolecular fiber organization
GO:0051495	0.878	positive regulation of cytoskeleton organization
GO:0110053	0.877	regulation of actin filament organization
GO:0032273	0.837	positive regulation of protein polymerization
GO:0008064	0.811	regulation of actin polymerization or depolymerization
GO:0030838	0.750	positive regulation of actin filament polymerization
GO:0051179	0.698	localization
GO:0051234	0.656	establishment of localization
GO:0006810	0.647	transport
GO:0006897	0.636	endocytosis
GO:0061024	0.336	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.997	endomembrane system
GO:0071944	0.996	cell periphery
GO:0005622	0.995	intracellular anatomical structure
GO:0043227	0.995	membrane-bounded organelle
GO:0005886	0.993	plasma membrane
GO:0005737	0.979	cytoplasm
GO:0043229	0.975	intracellular organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005829	0.927	cytosol
GO:0098590	0.791	plasma membrane region
GO:0005634	0.642	nucleus
GO:0042995	0.624	cell projection
GO:0098862	0.589	cluster of actin-based cell projections
GO:0120025	0.577	plasma membrane bounded cell projection
GO:0005905	0.513	clathrin-coated pit
GO:0043233	0.454	organelle lumen
GO:0043005	0.422	neuron projection
GO:0070013	0.413	intracellular organelle lumen
GO:0031981	0.400	nuclear lumen
GO:0032421	0.344	stereocilium bundle
GO:0098858	0.323	actin-based cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]