StarFunc result for job id O94874

User Input

>input (794 residues)
MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPA
QISKEMRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYL
DRLAEEVNDKLQESGQVTISELCKTYDLPGNFLTQALTQRLGRIISGHIDLDNRGVIFTE
AFVARHKARIRGLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQD
KAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAAC
VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFSKQASTVVFSD
TVVVSEKFINDCTELFRELMHQKAEKEMKNNPVHLITEEDLKQISTLESVSTSKKDKKDE
RRRKATEGSGSMRGGGGGNAREYKIKKVKKKGRKDDDSDDESQSSHTGKKKPEISFMFQD
EIEDFLRKHIQDAPEEFISELAEYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDL
QEEVSNLYNNIRLFEKGMKFFADDTQAALTKHLLKSVCTDITNLIFNFLASDLMMAVDDP
AAITSEIRKKILSKLSEETKVALTKLHNSLNEKSIEDFISCLDSAAEACDIMVKRGDKKR
ERQILFQHRQALAEQLKVTEDPALILHLTSVLLFQFSTHSMLHAPGRCVPQIIAFLNSKI
PEDQHALLVKYQGLVVKQLVSQSKKTGQGDYPLNNELDKEQEDVASTTRKELQELSSSIK
DLVLKSRKSSVTEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94874	1.000	1.000	0.000	794	1.000	1.000	O94874.pdb.gz	UFL1_HUMAN E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2
2	AFDB:Q9VI55	0.509	0.517	6.067E-53	782	0.351	0.357	Q9VI55.pdb.gz	UFL1_DROME E3 UFM1-protein ligase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Ufl1 PE=1 SV=1
3	AFDB:Q38AF6	0.433	0.461	1.414E-29	740	0.207	0.222	Q38AF6.pdb.gz	Q38AF6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2450 PE=3 SV=1
4	AFDB:Q7KRW8	0.085	0.069	1.880E-2	1066	0.127	0.095	Q7KRW8.pdb.gz	PRP39_DROME Pre-mRNA-processing factor 39 OS=Drosophila melanogaster OX=7227 GN=Prp39 PE=1 SV=1
5	PDB:7d58O	0.072	0.107	2.167E-2	490	0.064	0.104	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
6	PDB:5lzbz	0.125	0.151	3.741E-2	614	0.043	0.055	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
7	PDB:7z1mO	0.064	0.083	6.761E-2	570	0.067	0.093	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
8	AFDB:Q7YU43	0.085	0.072	8.067E-2	1004	0.058	0.046	Q7YU43.pdb.gz	Q7YU43_DROME RE33408p OS=Drosophila melanogaster OX=7227 GN=egl PE=2 SV=1
9	AFDB:Q57Y20	0.081	0.074	1.393E-1	915	0.112	0.097	Q57Y20.pdb.gz	Q57Y20_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.370 PE=4 SV=1
10	PDB:5afqB	0.068	0.115	1.466E-1	444	0.062	0.110	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
11	PDB:7asvA	0.072	0.289	1.759E-1	155	0.019	0.097	7asvA.pdb.gz
12	AFDB:Q52EB3	0.074	0.064	2.405E-1	982	0.065	0.053	Q52EB3.pdb.gz	ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=ATG1 PE=1 SV=1
13	PDB:3cuqA	0.091	0.267	3.037E-1	219	0.028	0.100	3cuqA.pdb.gz
14	PDB:5fj9O	0.074	0.103	3.037E-1	528	0.059	0.089	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
15	AFDB:Q38FE6	0.054	0.057	3.308E-1	704	0.068	0.077	Q38FE6.pdb.gz	Q38FE6_TRYB2 Translin-associated factor X-interacting protein 1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2470 PE=4 SV=1
16	PDB:1dcnB	0.078	0.122	3.813E-1	418	0.062	0.117	1dcnB.pdb.gz	Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
17	PDB:1keyB	0.056	0.146	3.990E-1	221	0.042	0.149	1keyB.pdb.gz
18	AFDB:Q9Y5P8	0.073	0.088	4.154E-1	575	0.077	0.106	Q9Y5P8.pdb.gz	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
19	AFDB:Q54T23	0.069	0.067	4.347E-1	855	0.123	0.115	Q54T23.pdb.gz	Q54T23_DICDI TPR repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282093 PE=4 SV=1
20	PDB:6f40P	0.090	0.214	4.371E-1	246	0.037	0.118	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A4I9	0.0	1448	792	0.927	0.929	UFL1_BOVIN E3 UFM1-protein ligase 1 OS=Bos taurus OX=9913 GN=UFL1 PE=2 SV=1
2	B2GV24	0.0	1419	793	0.907	0.908	UFL1_RAT E3 UFM1-protein ligase 1 OS=Rattus norvegicus OX=10116 GN=Ufl1 PE=1 SV=1
3	O94874	0.0	1629	794	1.000	1.000	UFL1_HUMAN E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2
4	Q8CCJ3	0.0	1415	793	0.906	0.907	UFL1_MOUSE E3 UFM1-protein ligase 1 OS=Mus musculus OX=10090 GN=Ufl1 PE=1 SV=2
5	Q9VI55	4.22e-149	457	782	0.356	0.362	UFL1_DROME E3 UFM1-protein ligase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Ufl1 PE=1 SV=1
6	Q38AF6	2.50e-32	136	740	0.102	0.109	Q38AF6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2450 PE=3 SV=1
7	Q6IUF8	0.38	37.0	2209	0.050	0.018	L_MACHU RNA-directed RNA polymerase L OS=Machupo virus OX=3052317 GN=L PE=1 SV=1
8	Q9UN74	2.1	34.3	947	0.025	0.021	PCDA4_HUMAN Protocadherin alpha-4 OS=Homo sapiens OX=9606 GN=PCDHA4 PE=1 SV=1
9	Q6E804	3.6	33.5	1013	0.029	0.023	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
10	O13912	9.6	32.0	535	0.043	0.064	YDW6_SCHPO Uncharacterized protein C23C11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23C11.06c PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	1.1e+02	14.5	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF19615 DUF6120	19	16.7	Family of unknown function (DUF6120)
3	PF20184 DUF6547	2.4e+02	13.5	Family of unknown function (DUF6547)
4	PF09743 E3_UFM1_ligase	3.4e-111	382.8	E3 UFM1-protein ligase 1
5	PF15209 IL31	43	15.3	Interleukin 31
6	PF14075 UBN_AB	5.7e+02	11.6	Ubinuclein conserved middle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358283

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438886	0.997	CDK5 regulatory subunit-associated protein 3
2	9606.ENSP00000346483	0.991	DDRGK domain-containing protein 1
3	9606.ENSP00000368970	0.951	Ubiquitin-fold modifier 1
4	9606.ENSP00000356982	0.933	Ubiquitin-fold modifier-conjugating enzyme 1
5	9606.ENSP00000264689	0.930	Ufm1-specific protease 2
6	9606.ENSP00000348565	0.929	Ubiquitin-like modifier-activating enzyme 5
7	9606.ENSP00000373413	0.844	Inactive Ufm1-specific protease 1
8	9606.ENSP00000313854	0.788	Cleft lip and palate transmembrane protein 1-like protein
9	9606.ENSP00000383118	0.726	Cell division control protein 42 homolog
10	9606.ENSP00000356563	0.685	Peroxisomal biogenesis factor 3
11	9606.ENSP00000354340	0.645	NEDD8-activating enzyme E1 catalytic subunit
12	9606.ENSP00000241502	0.632	UAP56-interacting factor
13	9606.ENSP00000418401	0.623	Signal recognition particle receptor subunit beta
14	9606.ENSP00000323302	0.622	POC1 centriolar protein homolog B
15	9606.ENSP00000361405	0.608	Matrix metalloproteinase-9
16	9606.ENSP00000370200	0.606	snRNA-activating protein complex subunit 3
17	9606.ENSP00000300107	0.605	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
18	9606.ENSP00000410409	0.604	TATA box-binding protein-associated factor RNA polymerase I subunit D
19	9606.ENSP00000363574	0.595	Eukaryotic translation initiation factor 6
20	9606.ENSP00000357880	0.582	S-adenosylmethionine decarboxylase proenzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.996	catalytic activity
GO:0019899	0.986	enzyme binding
GO:0019787	0.986	ubiquitin-like protein transferase activity
GO:0061659	0.981	ubiquitin-like protein ligase activity
GO:0019901	0.981	protein kinase binding
GO:0061666	0.941	UFM1 ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0051716	0.905	cellular response to stimulus
GO:0071704	0.904	organic substance metabolic process
GO:0048583	0.875	regulation of response to stimulus
GO:0006807	0.874	nitrogen compound metabolic process
GO:0044238	0.871	primary metabolic process
GO:0048523	0.860	negative regulation of cellular process
GO:0031323	0.856	regulation of cellular metabolic process
GO:0043170	0.855	macromolecule metabolic process
GO:1901564	0.834	organonitrogen compound metabolic process
GO:0006950	0.822	response to stress
GO:0019538	0.810	protein metabolic process
GO:0023051	0.778	regulation of signaling
GO:0010646	0.777	regulation of cell communication
GO:0009966	0.770	regulation of signal transduction
GO:0033554	0.751	cellular response to stress
GO:0043412	0.725	macromolecule modification
GO:0044237	0.714	cellular metabolic process
GO:0048522	0.708	positive regulation of cellular process
GO:0060255	0.694	regulation of macromolecule metabolic process
GO:0071840	0.692	cellular component organization or biogenesis
GO:0036211	0.688	protein modification process
GO:0032446	0.659	protein modification by small protein conjugation
GO:0016043	0.645	cellular component organization
GO:0034976	0.632	response to endoplasmic reticulum stress
GO:0032502	0.552	developmental process
GO:0006996	0.545	organelle organization
GO:0032501	0.508	multicellular organismal process
GO:0009056	0.481	catabolic process
GO:0010468	0.382	regulation of gene expression
GO:0044248	0.354	cellular catabolic process
GO:0009894	0.346	regulation of catabolic process
GO:0051171	0.328	regulation of nitrogen compound metabolic process
GO:0080090	0.322	regulation of primary metabolic process
GO:0009892	0.313	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0012505	0.966	endomembrane system
GO:0016020	0.932	membrane
GO:0032991	0.892	protein-containing complex
GO:0043232	0.875	intracellular non-membrane-bounded organelle
GO:0005783	0.755	endoplasmic reticulum
GO:0031984	0.715	organelle subcompartment
GO:0042175	0.674	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.672	endoplasmic reticulum subcompartment
GO:0031090	0.670	organelle membrane
GO:0005789	0.662	endoplasmic reticulum membrane
GO:0005829	0.482	cytosol
GO:0070013	0.439	intracellular organelle lumen
GO:0031981	0.434	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.986	Transferases.

[back to server]