StarFunc result for job id O94875

User Input

>input (1100 residues)
MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEE
EKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNT
PYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPL
RPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPASLYQSSIDRSL
ERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSP
SSPSRAKGGDDSKICPSLCSYSGLNGNPSSELDYCSTYRQHLDVPRDSPRAISFKNGWQM
ARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPM
AWGSPYVPEVRSNGRSRIRHRSARNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQY
ESEQQHKDLLRAWSQCSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDDMLSPVTLEPPQ
NGLCPKRRFSIEYLLEEENQSGPPARGRRGCQSNALVPIHIEVTSDEQPRAHVEFSDSDQ
DGVVSDHSDYIHLEGSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHHRHLISSCKGR
CPASYTRFTTMLKHERARHENTEEPRRQEMDPGLSKLAFLVSPVPFRRKKNSAPKKQTEK
AKCKASVFEALDSALKDICDQIKAEKKRGSLPDNSILHRLISELLPDVPERNSSLRALRR
SPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPR
SYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNW
YEGEHHGRVGIFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLR
KGDRVILLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDR
IHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFV
GTSRRTKFFGTFPGNYVKRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94875	1.000	1.000	0.000	1100	1.000	1.000	O94875.pdb.gz	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
2	AFDB:Q62417	0.084	0.074	6.856E-41	1290	0.332	0.283	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
3	AFDB:A0A0U1RQE4	0.073	0.075	7.139E-22	1047	0.164	0.172	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
4	AFDB:A0A494C1M0	0.076	0.081	1.184E-20	1011	0.166	0.181	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
5	PDB:1griA	0.057	0.263	6.793E-9	211	0.056	0.294	1griA.pdb.gz
6	PDB:2lqnA	0.073	0.189	2.847E-8	303	0.041	0.149	2lqnA.pdb.gz
7	PDB:2eyzA	0.059	0.178	2.489E-6	304	0.034	0.122	2eyzA.pdb.gz
8	PDB:2dybA	0.053	0.188	1.389E-5	298	0.028	0.104	2dybA.pdb.gz
9	PDB:3ehqA	0.050	0.291	6.529E-5	182	0.018	0.110	3ehqA.pdb.gz
10	PDB:1k9aB	0.055	0.134	7.754E-5	441	0.024	0.059	1k9aB.pdb.gz
11	PDB:6x5hA	0.053	0.124	1.226E-4	467	0.015	0.034	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
12	AFDB:Q3LHL9	0.041	0.031	1.692E-4	1658	0.135	0.089	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
13	PDB:3qwyA	0.058	0.332	2.736E-4	170	0.020	0.129	3qwyA.pdb.gz
14	PDB:4mt6A	0.048	0.133	4.087E-4	389	0.017	0.049	4mt6A.pdb.gz
15	PDB:2h8hA	0.048	0.117	5.443E-4	445	0.015	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	AFDB:P47136	0.052	0.046	9.350E-3	1447	0.125	0.095	P47136.pdb.gz	BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD4 PE=1 SV=2
17	AFDB:B1AR09	0.054	0.055	1.756E-2	1079	0.125	0.128	B1AR09.pdb.gz	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
18	AFDB:B1AR10	0.042	0.042	3.299E-2	1109	0.120	0.119	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
19	AFDB:P14737	0.043	0.037	3.494E-2	1309	0.124	0.104	P14737.pdb.gz	RAD9_YEAST DNA repair protein RAD9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD9 PE=1 SV=2
20	AFDB:Q57U60	0.039	0.038	3.700E-2	1172	0.129	0.121	Q57U60.pdb.gz	Q57U60_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35413	0.0	1885	1196	0.881	0.810	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
2	O94875	0.0	2274	1100	1.000	1.000	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
3	Q3UTJ2	0.0	1848	1180	0.876	0.817	SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sorbs2 PE=1 SV=2
4	Q62417	2.12e-82	295	1290	0.133	0.113	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
5	Q966U7	4.58e-66	227	313	0.111	0.390	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
6	Q8IGB7	1.07e-65	228	350	0.111	0.349	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
7	Q9R1Z8	1.05e-63	233	733	0.114	0.171	VINEX_MOUSE Vinexin OS=Mus musculus OX=10090 GN=Sorbs3 PE=1 SV=1
8	Q7K1M7	1.52e-63	226	500	0.111	0.244	Q7K1M7_DROME CAP, isoform G OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
9	D3DMM3	2.68e-63	227	554	0.111	0.220	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
10	A1Z870	5.21e-63	227	565	0.111	0.216	A1Z870_DROME CAP, isoform J OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
11	Q966U8	6.87e-63	225	527	0.111	0.231	Q966U8_DROME DCAPL4 OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
12	A1Z872	8.18e-63	225	527	0.111	0.231	A1Z872_DROME CAP, isoform D OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
13	A1Z866	1.16e-62	228	639	0.111	0.191	A1Z866_DROME CAP, isoform I OS=Drosophila melanogaster OX=7227 GN=CAP PE=1 SV=1
14	Q8IGN4	1.65e-62	227	647	0.111	0.189	Q8IGN4_DROME RE58362p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
15	Q86P80	4.26e-62	226	630	0.111	0.194	Q86P80_DROME CAP, isoform K OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
16	O60504	8.98e-62	226	671	0.116	0.191	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
17	A0A0B4K7W2	9.84e-62	226	674	0.111	0.181	A0A0B4K7W2_DROME CAP, isoform U OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
18	A0A0B4K7L3	3.91e-61	232	2505	0.111	0.049	A0A0B4K7L3_DROME CAP, isoform X OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
19	B7YZD9	3.92e-61	232	2365	0.111	0.052	B7YZD9_DROME CAP, isoform L OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
20	A0A0B4KEJ6	4.00e-61	231	1586	0.111	0.077	A0A0B4KEJ6_DROME CAP, isoform W OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	3.2e-38	140.4	SH3 domain
2	PF07653 SH3_2	1.1e-25	100.5	Variant SH3 domain
3	PF14604 SH3_9	7.5e-35	130.0	Variant SH3 domain
4	PF02208 Sorb	6.9e-25	97.7	Sorbin homologous domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347852

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.926	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000361423	0.828	Tyrosine-protein kinase ABL1
3	9606.ENSP00000425556	0.768	Palladin
4	9606.ENSP00000376368	0.763	Wiskott-Aldrich syndrome protein family member 1
5	9606.ENSP00000480359	0.759	PDZ and LIM domain protein 5
6	9606.ENSP00000264554	0.730	SHC-transforming protein 2
7	9606.ENSP00000211998	0.647	Vinculin
8	9606.ENSP00000264335	0.626	14-3-3 protein epsilon
9	9606.ENSP00000365569	0.625	Flotillin-1
10	9606.ENSP00000284770	0.621	PDZ and LIM domain protein 3
11	9606.ENSP00000360293	0.591	Sorbin and SH3 domain-containing protein 1
12	9606.ENSP00000281172	0.579	Epidermal growth factor receptor kinase substrate 8
13	9606.ENSP00000403636	0.566	Ras/Rap GTPase-activating protein SynGAP
14	9606.ENSP00000316377	0.534	Disks large-associated protein 1
15	9606.ENSP00000320117	0.530	Cdc42-interacting protein 4
16	9606.ENSP00000382428	0.529	Disks large homolog 4
17	9606.ENSP00000362444	0.526	Disks large-associated protein 3
18	9606.ENSP00000358866	0.524	Filamin-A
19	9606.ENSP00000257414	0.523	Semaphorin-6A
20	9606.ENSP00000377941	0.514	Alpha-actinin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.860	organic cyclic compound binding
GO:1901363	0.842	heterocyclic compound binding
GO:0060090	0.826	molecular adaptor activity
GO:0042802	0.808	identical protein binding
GO:0003676	0.783	nucleic acid binding
GO:0005198	0.779	structural molecule activity
GO:0003723	0.773	RNA binding
GO:0030674	0.739	protein-macromolecule adaptor activity
GO:0005200	0.710	structural constituent of cytoskeleton
GO:0008093	0.553	cytoskeletal anchor activity
GO:0008307	0.513	structural constituent of muscle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.941	regulation of biological process
GO:0050794	0.932	regulation of cellular process
GO:0050896	0.569	response to stimulus
GO:0032501	0.489	multicellular organismal process
GO:0007154	0.469	cell communication
GO:0048518	0.465	positive regulation of biological process
GO:0007165	0.457	signal transduction
GO:0071840	0.449	cellular component organization or biogenesis
GO:0048522	0.429	positive regulation of cellular process
GO:0019222	0.420	regulation of metabolic process
GO:0048856	0.394	anatomical structure development
GO:0016043	0.373	cellular component organization
GO:0048519	0.317	negative regulation of biological process
GO:0048523	0.313	negative regulation of cellular process
GO:0008152	0.312	metabolic process
GO:0031323	0.306	regulation of cellular metabolic process
GO:0060255	0.304	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.997	intracellular organelle
GO:0005737	0.991	cytoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0005634	0.990	nucleus
GO:0005829	0.975	cytosol
GO:0005856	0.930	cytoskeleton
GO:0030054	0.925	cell junction
GO:0015629	0.866	actin cytoskeleton
GO:0031974	0.639	membrane-enclosed lumen
GO:0042995	0.538	cell projection
GO:0045202	0.513	synapse
GO:0070013	0.445	intracellular organelle lumen
GO:0031981	0.387	nuclear lumen
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]