StarFunc result for job id O94885

User Input

>input (1247 residues)
MEDAGAAGPGPEPEPEPEPEPEPAPEPEPEPKPGAGTSEAFSRLWTDVMGILDGSLGNID
DLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSA
VSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVAS
EITMSDEERIQLMMMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSS
NCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEEMKKPSTEGGEEHVFENSPVL
DERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKLVKTFSKGESR
GLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHV
GSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRKRMSKKYSSSVSEQDSGL
DGMPGSPPPSQPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVK
SEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNN
KVGTFKFIYVDVLSEDEEKPKRPTRRRRKGRPPQPKSVEDLLDRINLKEHMPTFLFNGYE
DLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSQGLSGC
SPRDSGCYESSENLENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQ
GQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSHSL
DDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRF
SEPQKLTTKKLEGSIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGT
HHPLGTKEGVDAEQRMQPKIPSQPPPVPAKKSRERLANGLHPVPMGPSGALPSPDAPCLP
VKRGSPASPTSPSDCPPALAPRPLSGQAPGSPPSTRPPPWLSELPENTSLQEHGVKLGPA
LTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERD
VAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLST
AGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLPPGPEAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94885	1.000	1.000	0.000	1247	1.000	1.000	O94885.pdb.gz	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
2	AFDB:P59808	0.240	0.243	0.000	1230	0.852	0.864	P59808.pdb.gz	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
3	AFDB:Q8SZS0	0.079	0.092	1.335E-17	952	0.129	0.169	Q8SZS0.pdb.gz	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
4	AFDB:Q9NZ56	0.043	0.037	1.067E-3	1722	0.148	0.107	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
5	AFDB:Q9W0B0	0.039	0.042	1.657E-3	1107	0.108	0.122	Q9W0B0.pdb.gz	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
6	PDB:2dybA	0.045	0.180	2.049E-3	298	0.014	0.057	2dybA.pdb.gz
7	AFDB:Q9VVC6	0.047	0.041	3.782E-3	2029	0.136	0.084	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
8	PDB:2lqnA	0.049	0.190	3.964E-3	303	0.018	0.073	2lqnA.pdb.gz
9	AFDB:Q24079	0.037	0.038	4.460E-3	1221	0.139	0.142	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
10	AFDB:Q9JL04	0.031	0.027	5.260E-3	1578	0.131	0.103	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
11	PDB:3qwyA	0.048	0.334	5.514E-3	170	0.010	0.076	3qwyA.pdb.gz
12	PDB:1griA	0.045	0.257	6.871E-3	211	0.010	0.062	1griA.pdb.gz
13	PDB:3ehqA	0.042	0.274	8.104E-3	182	0.011	0.077	3ehqA.pdb.gz
14	PDB:2eyzA	0.051	0.197	1.127E-2	304	0.018	0.076	2eyzA.pdb.gz
15	AFDB:Q9HCM7	0.038	0.045	1.136E-2	1045	0.141	0.168	Q9HCM7.pdb.gz	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
16	PDB:1k9aB	0.044	0.121	1.329E-2	441	0.008	0.023	1k9aB.pdb.gz
17	AFDB:A0A0B4KI34	0.049	0.060	2.593E-2	941	0.101	0.134	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
18	PDB:6x5hA	0.046	0.120	2.872E-2	467	0.010	0.026	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
19	PDB:1k0xA	0.044	0.465	3.205E-2	108	0.011	0.130	1k0xA.pdb.gz
20	PDB:2h8hA	0.043	0.117	4.977E-2	445	0.009	0.025	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94885	0.0	2539	1247	1.000	1.000	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
2	P59808	0.0	2036	1230	0.856	0.867	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
3	Q8K352	3.16e-66	231	380	0.110	0.361	SASH3_MOUSE SAM and SH3 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sash3 PE=1 SV=2
4	P57725	1.40e-55	200	372	0.126	0.422	SAMN1_MOUSE SAM domain-containing protein SAMSN-1 OS=Mus musculus OX=10090 GN=Samsn1 PE=1 SV=2
5	Q9NSI8	4.09e-54	196	373	0.122	0.408	SAMN1_HUMAN SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1
6	Q8T9B0	7.29e-33	139	778	0.070	0.112	Q8T9B0_DROME SD09611p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
7	A0A0B4KHM3	4.67e-32	138	1027	0.070	0.085	A0A0B4KHM3_DROME Shal K[+] channel interacting protein, isoform J OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
8	Q0KI30	4.83e-32	138	1064	0.070	0.082	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
9	Q8SZS0	5.99e-32	137	952	0.070	0.091	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
10	A0A0B4KHV7	6.15e-32	137	1080	0.070	0.081	A0A0B4KHV7_DROME Shal K[+] channel interacting protein, isoform I OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
11	A0A0B4K6C1	1.01e-31	137	1034	0.070	0.084	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
12	Q95RX2	3.57e-18	87.4	237	0.045	0.236	Q95RX2_DROME LD04190p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
13	Q5TGI4	1.44e-05	49.3	173	0.018	0.133	SAMD5_HUMAN Sterile alpha motif domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SAMD5 PE=1 SV=1
14	Q7K115	4.48e-05	50.1	598	0.018	0.038	Q7K115_DROME LD16982p OS=Drosophila melanogaster OX=7227 GN=Nost PE=2 SV=1
15	H1UUM2	4.79e-05	50.1	768	0.018	0.030	H1UUM2_DROME FI17805p1 OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
16	D5SHR1	4.92e-05	50.1	671	0.018	0.034	D5SHR1_DROME IP05844p OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
17	M9MQH0	5.24e-05	50.1	675	0.018	0.034	M9MQH0_DROME Nostrin, isoform D OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
18	X2JAX8	5.71e-05	50.1	1330	0.018	0.017	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
19	B5RJS0	5.82e-05	50.1	1225	0.018	0.019	B5RJS0_DROME IP20241p OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
20	Q3V1H9	6.34e-05	47.4	173	0.018	0.127	SAMD5_MOUSE Sterile alpha motif domain-containing protein 5 OS=Mus musculus OX=10090 GN=Samd5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19850 DUF6325	3.8e+02	12.2	Family of unknown function (DUF6325)
2	PF00536 SAM_1	8.7e-14	63.0	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	1.2e-16	71.9	SAM domain (Sterile alpha motif)
4	PF00018 SH3_1	32	15.6	SH3 domain
5	PF07653 SH3_2	0.12	23.6	Variant SH3 domain
6	PF12485 SLY	3.3e-38	143.3	Lymphocyte signaling adaptor protein
7	PF05887 Trypan_PARP	1.2	20.5	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356437

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380019	0.819	Zinc finger protein 384
2	9606.ENSP00000312250	0.817	ADP-dependent glucokinase
3	9606.ENSP00000380793	0.817	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
4	9606.ENSP00000385722	0.817	Integrator complex subunit 1
5	9606.ENSP00000454646	0.817	Putative sodium-coupled neutral amino acid transporter 7
6	9606.ENSP00000370981	0.811	Leucine zipper putative tumor suppressor 1
7	9606.ENSP00000356444	0.738	Sterile alpha motif domain containing 5
8	9606.ENSP00000334153	0.676	Raftlin
9	9606.ENSP00000346997	0.659	Histone-lysine N-methyltransferase SUV39H2
10	9606.ENSP00000367823	0.634	Protein FAM214B
11	9606.ENSP00000254667	0.611	Receptor-type tyrosine-protein phosphatase epsilon
12	9606.ENSP00000399718	0.598	MAP3K12-binding inhibitory protein 1
13	9606.ENSP00000417183	0.592	Dual specificity protein phosphatase 7
14	9606.ENSP00000267615	0.588	Inositol-tetrakisphosphate 1-kinase
15	9606.ENSP00000262134	0.584	Lysophosphatidylcholine acyltransferase 2
16	9606.ENSP00000330148	0.578	Glutamate receptor ionotropic, delta-1
17	9606.ENSP00000301732	0.574	ATP-binding cassette sub-family A member 3
18	9606.ENSP00000371211	0.574	Transmembrane protease serine 6
19	9606.ENSP00000360108	0.567	Putative tyrosine-protein phosphatase auxilin
20	9606.ENSP00000482968	0.560	Alstrom syndrome protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.988	enzyme binding
GO:0019901	0.979	protein kinase binding
GO:0060090	0.978	molecular adaptor activity
GO:0001965	0.924	G-protein alpha-subunit binding
GO:0031435	0.921	mitogen-activated protein kinase kinase kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0048583	0.961	regulation of response to stimulus
GO:0044238	0.959	primary metabolic process
GO:0071704	0.958	organic substance metabolic process
GO:1901564	0.952	organonitrogen compound metabolic process
GO:0019220	0.952	regulation of phosphate metabolic process
GO:0048522	0.949	positive regulation of cellular process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0080090	0.946	regulation of primary metabolic process
GO:0009966	0.941	regulation of signal transduction
GO:0031399	0.941	regulation of protein modification process
GO:0042325	0.935	regulation of phosphorylation
GO:1902531	0.934	regulation of intracellular signal transduction
GO:0048584	0.923	positive regulation of response to stimulus
GO:0001932	0.908	regulation of protein phosphorylation
GO:0051239	0.903	regulation of multicellular organismal process
GO:0009987	0.871	cellular process
GO:0043170	0.859	macromolecule metabolic process
GO:0051173	0.752	positive regulation of nitrogen compound metabolic process
GO:0043412	0.744	macromolecule modification
GO:0031325	0.717	positive regulation of cellular metabolic process
GO:0019538	0.713	protein metabolic process
GO:0023056	0.680	positive regulation of signaling
GO:0065009	0.679	regulation of molecular function
GO:0010647	0.679	positive regulation of cell communication
GO:0036211	0.673	protein modification process
GO:0009967	0.656	positive regulation of signal transduction
GO:0043408	0.536	regulation of MAPK cascade
GO:0050790	0.477	regulation of catalytic activity
GO:1902533	0.450	positive regulation of intracellular signal transduction
GO:0031401	0.437	positive regulation of protein modification process
GO:0050896	0.430	response to stimulus
GO:0080134	0.426	regulation of response to stress
GO:0048519	0.422	negative regulation of biological process
GO:0051240	0.418	positive regulation of multicellular organismal process
GO:0044093	0.412	positive regulation of molecular function
GO:0043549	0.412	regulation of kinase activity
GO:0050793	0.398	regulation of developmental process
GO:0032101	0.396	regulation of response to external stimulus
GO:0002831	0.375	regulation of response to biotic stimulus
GO:0048523	0.343	negative regulation of cellular process
GO:0051094	0.334	positive regulation of developmental process
GO:0044237	0.328	cellular metabolic process
GO:0032103	0.325	positive regulation of response to external stimulus
GO:0002833	0.321	positive regulation of response to biotic stimulus
GO:2000145	0.320	regulation of cell motility
GO:0043085	0.319	positive regulation of catalytic activity
GO:0045859	0.319	regulation of protein kinase activity
GO:0043410	0.318	positive regulation of MAPK cascade
GO:0022603	0.317	regulation of anatomical structure morphogenesis
GO:0001934	0.316	positive regulation of protein phosphorylation
GO:0071900	0.314	regulation of protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0016020	0.995	membrane
GO:0032991	0.988	protein-containing complex
GO:0043227	0.925	membrane-bounded organelle
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0005829	0.491	cytosol
GO:0005634	0.406	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]