StarFunc result for job id O94886

User Input

>input (807 residues)
MMDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSC
FLFLILVFSIIRRRFWDYGRIALVSEADSESRFQRLSSTSSSGQQDFENELGCCPWLTAI
FRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGR
TTIANLQTDNDLLWLHTIFAVIYLFLTVGFMRHHTQSIKYKEENLVRRTLFITGLPRDAR
KETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLIN
PKPCGQFCCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMAFVTFQEKSMA
TYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWL
QWLGINFTLFLGLFFLTTPSIILSTMDKFNVTKPIHALNNPIISQFFPTLLLWSFSALLP
SIVYYSTLLESHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEA
SIRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQN
QAFQYEFGAMYAWMLCVFTVIVAYSITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLE
KGIHFAAVNQALAAPILCLFWLYFFSFLRLGMKAPATLFTFLVLLLTILVCLAHTCFGCF
KHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTALSPQQQQQQTYGAI
HNISGTIPGQCLAQSATGSVAAAPQEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1NY77	0.917	0.917	0.000	807	1.000	1.000	A1NY77.pdb.gz
2	AFDB:Q3TWI9	0.838	0.814	7.813E-72	832	0.555	0.538	Q3TWI9.pdb.gz	CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus OX=10090 GN=Tmem63b PE=1 SV=1
3	AFDB:X1WEM4	0.843	0.825	2.773E-62	825	0.441	0.432	X1WEM4.pdb.gz	CSC1_DANRE Calcium permeable stress-gated cation channel 1 OS=Danio rerio OX=7955 GN=tmem63c PE=3 SV=1
4	AFDB:Q9P1W3	0.818	0.819	8.439E-59	806	0.384	0.385	Q9P1W3.pdb.gz	CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens OX=9606 GN=TMEM63C PE=1 SV=1
5	AFDB:D3ZNF5	0.829	0.834	5.552E-57	802	0.390	0.393	D3ZNF5.pdb.gz	CSC1_RAT Calcium permeable stress-gated cation channel 1 OS=Rattus norvegicus OX=10116 GN=Tmem63c PE=1 SV=1
6	AFDB:Q6NP91	0.714	0.755	2.743E-41	760	0.300	0.318	Q6NP91.pdb.gz	Q6NP91_DROME RE44586p OS=Drosophila melanogaster OX=7227 GN=Tmem63 PE=1 SV=1
7	AFDB:B5TYT3	0.667	0.695	3.495E-27	771	0.187	0.196	B5TYT3.pdb.gz	CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana OX=3702 GN=At1g11960 PE=2 SV=1
8	AFDB:Q5XEZ5	0.677	0.706	5.865E-26	771	0.185	0.193	Q5XEZ5.pdb.gz	CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana OX=3702 GN=CSC1 PE=1 SV=1
9	AFDB:Q9FVQ5	0.689	0.690	8.345E-26	806	0.185	0.185	Q9FVQ5.pdb.gz	CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana OX=3702 GN=At1g32090 PE=1 SV=1
10	AFDB:A9LIW2	0.611	0.674	1.928E-25	723	0.191	0.213	A9LIW2.pdb.gz	CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea OX=3707 GN=ERD4 PE=3 SV=2
11	PDB:6mgvA	0.573	0.709	2.578E-21	634	0.165	0.210	6mgvA.pdb.gz
12	PDB:6ijzA	0.626	0.727	2.045E-20	683	0.157	0.186	6ijzA.pdb.gz
13	PDB:6jpfA	0.561	0.721	4.472E-19	610	0.159	0.210	6jpfA.pdb.gz
14	PDB:6oceA	0.596	0.684	1.056E-16	689	0.188	0.221	6oceA.pdb.gz
15	PDB:5z1fA	0.525	0.683	6.948E-15	601	0.155	0.208	5z1fA.pdb.gz
16	PDB:7rxgB	0.250	0.298	1.957E-4	650	0.074	0.092	7rxgB.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
17	PDB:6r7xA	0.217	0.262	2.549E-4	629	0.069	0.089	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
18	PDB:7rx3B	0.248	0.323	5.160E-4	591	0.058	0.080	7rx3B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
19	PDB:7zk3A	0.236	0.260	6.432E-4	721	0.063	0.071	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
20	PDB:6oy3B	0.239	0.308	7.025E-4	594	0.061	0.082	6oy3B.pdb.gz	Dynamic modulation of the lipid translocation groove generates a conductive ion channel in Ca 2+ -bound nhTMEM16.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A452G813	0.0	1465	803	0.897	0.902	CSCL1_CAPHI CSC1-like protein 1 OS=Capra hircus OX=9925 GN=TMEM63A PE=1 SV=2
2	B3KMR6	0.0	1663	807	0.993	0.993	B3KMR6_HUMAN cDNA FLJ12440 fis, clone NT2RM1000131, highly similar to Homo sapiens transmembrane protein 63A (TMEM63A), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	D3ZNF5	0.0	572	802	0.371	0.373	CSC1_RAT Calcium permeable stress-gated cation channel 1 OS=Rattus norvegicus OX=10116 GN=Tmem63c PE=1 SV=1
4	H3BLW6	0.0	848	761	0.520	0.552	H3BLW6_HUMAN Transmembrane protein 63B (Fragment) OS=Homo sapiens OX=9606 GN=TMEM63B PE=1 SV=1
5	O94886	0.0	1675	807	1.000	1.000	CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens OX=9606 GN=TMEM63A PE=1 SV=3
6	Q3TWI9	0.0	890	832	0.551	0.535	CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus OX=10090 GN=Tmem63b PE=1 SV=1
7	Q5T3F8	0.0	892	832	0.550	0.534	CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens OX=9606 GN=TMEM63B PE=1 SV=1
8	Q8CBX0	0.0	575	802	0.384	0.387	CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus OX=10090 GN=Tmem63c PE=1 SV=1
9	Q91YT8	0.0	1467	804	0.897	0.900	CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus OX=10090 GN=Tmem63a PE=1 SV=1
10	Q9P1W3	0.0	592	806	0.387	0.387	CSC1_HUMAN Calcium permeable stress-gated cation channel 1 OS=Homo sapiens OX=9606 GN=TMEM63C PE=1 SV=1
11	X1WEM4	0.0	697	825	0.454	0.444	CSC1_DANRE Calcium permeable stress-gated cation channel 1 OS=Danio rerio OX=7955 GN=tmem63c PE=3 SV=1
12	Q6NP91	1.38e-130	409	760	0.310	0.329	Q6NP91_DROME RE44586p OS=Drosophila melanogaster OX=7227 GN=Tmem63 PE=1 SV=1
13	Q5TKG1	3.22e-32	136	766	0.173	0.183	Q5TKG1_ORYSJ Os05g0594700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0594700 PE=1 SV=1
14	B5TYT3	5.48e-26	116	771	0.175	0.183	CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana OX=3702 GN=At1g11960 PE=2 SV=1
15	Q9C8G5	8.69e-26	115	724	0.178	0.199	CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana OX=3702 GN=ERD4 PE=1 SV=1
16	Q5XEZ5	3.79e-25	114	771	0.180	0.188	CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana OX=3702 GN=CSC1 PE=1 SV=1
17	A9LIW2	4.00e-25	114	723	0.203	0.227	CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea OX=3707 GN=ERD4 PE=3 SV=2
18	Q8GUH7	2.38e-23	108	703	0.211	0.242	CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana OX=3702 GN=HYP1 PE=2 SV=1
19	Q9XEA1	2.31e-22	105	772	0.171	0.179	CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana OX=3702 GN=OSCA1 PE=1 SV=1
20	Q9FVQ5	9.96e-21	100	806	0.138	0.138	CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana OX=3702 GN=At1g32090 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14703 PHM7_cyt	8.4e-41	151.6	Cytosolic domain of 10TM putative phosphate transporter
2	PF00076 RRM_1	0.94	20.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF02714 RSN1_7TM	5.6e-50	181.8	Calcium-dependent channel, 7TM region, putative phosphate
4	PF13967 RSN1_TM	2.7e-17	74.5	Late exocytosis, associated with Golgi transport

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222284	0.753	Acts as a negative regulator of CHRM3 function, most likely by interfering with its trafficking to the cell membrane . Negatively regulates CHRM3-mediated calcium mobilization and activation of RPS6KA1/p90RSK activity
2	9606.ENSP00000405926	0.746	Transmembrane emp24 domain-containing protein 7
3	9606.ENSP00000323300	0.707	Sperm-associated antigen 5
4	9606.ENSP00000282369	0.700	E3 ubiquitin-protein ligase TRIM36
5	9606.ENSP00000282382	0.692	Transmembrane emp24 domain-containing protein 7
6	9606.ENSP00000309792	0.661	Belongs to the TMEM234 family
7	9606.ENSP00000272252	0.660	Aldose 1-epimerase
8	9606.ENSP00000264265	0.657	Latexin
9	9606.ENSP00000181839	0.625	Cyclin-dependent kinase 13
10	9606.ENSP00000342502	0.579	Pyrroline-5-carboxylate reductase 2
11	9606.ENSP00000366273	0.570	Zinc finger protein 157
12	9606.ENSP00000349689	0.561	Palmitoyltransferase ZDHHC9
13	9606.ENSP00000415203	0.556	GPI ethanolamine phosphate transferase 2
14	9606.ENSP00000380679	0.553	Coiled-coil domain-containing protein 40
15	9606.ENSP00000300557	0.533	Proline-rich protein 15-like protein
16	9606.ENSP00000360485	0.526	A-kinase anchor protein 14
17	9606.ENSP00000350263	0.518	GPI ethanolamine phosphate transferase 1
18	9606.ENSP00000246117	0.508	Nicalin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008381	1.000	mechanosensitive monoatomic ion channel activity
GO:0005515	0.987	protein binding
GO:0005261	0.961	monoatomic cation channel activity
GO:0022890	0.921	inorganic cation transmembrane transporter activity
GO:0140299	0.881	small molecule sensor activity
GO:0004888	0.852	transmembrane signaling receptor activity
GO:0005034	0.737	osmosensor activity
GO:0005227	0.628	calcium activated cation channel activity
GO:1990760	0.484	osmolarity-sensing monoatomic cation channel activity
GO:0003676	0.326	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.950	regulation of metabolic process
GO:0032879	0.947	regulation of localization
GO:0051049	0.905	regulation of transport
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0010468	0.886	regulation of gene expression
GO:0060627	0.859	regulation of vesicle-mediated transport
GO:0080164	0.806	regulation of nitric oxide metabolic process
GO:0050764	0.806	regulation of phagocytosis
GO:0031323	0.783	regulation of cellular metabolic process
GO:0009889	0.748	regulation of biosynthetic process
GO:0031326	0.742	regulation of cellular biosynthetic process
GO:0051239	0.723	regulation of multicellular organismal process
GO:0045428	0.666	regulation of nitric oxide biosynthetic process
GO:0070663	0.656	regulation of leukocyte proliferation
GO:0009987	0.561	cellular process
GO:0001817	0.556	regulation of cytokine production
GO:0032944	0.426	regulation of mononuclear cell proliferation
GO:0051179	0.362	localization
GO:0008152	0.350	metabolic process
GO:0071704	0.338	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.995	cytoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0031090	0.965	organelle membrane
GO:0071944	0.964	cell periphery
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0005886	0.952	plasma membrane
GO:0005856	0.582	cytoskeleton
GO:0012505	0.484	endomembrane system
GO:0031981	0.419	nuclear lumen
GO:0005654	0.388	nucleoplasm
GO:0005815	0.320	microtubule organizing center
GO:0005813	0.305	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]