StarFunc result for job id O94887

User Input

>input (1054 residues)
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94887	1.000	1.000	0.000	1054	1.000	1.000	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
2	AFDB:Q91VS8	0.846	0.838	0.000	1065	0.834	0.825	Q91VS8.pdb.gz	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
3	AFDB:F1LYQ8	0.760	0.764	3.770E-97	1049	0.545	0.547	F1LYQ8.pdb.gz	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
4	AFDB:B8JHS0	0.313	0.405	4.251E-38	811	0.236	0.307	B8JHS0.pdb.gz
5	AFDB:A2AD83	0.309	0.461	2.466E-33	703	0.209	0.313	A2AD83.pdb.gz	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
6	AFDB:Q6ZUT3	0.307	0.451	2.925E-33	714	0.198	0.293	Q6ZUT3.pdb.gz	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
7	AFDB:O17905	0.306	0.296	9.296E-31	1091	0.174	0.168	O17905.pdb.gz	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
8	AFDB:E9PHY5	0.296	0.333	5.359E-29	935	0.162	0.183	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
9	AFDB:A0A2R8Y5B3	0.298	0.379	9.334E-29	824	0.166	0.212	A0A2R8Y5B3.pdb.gz	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
10	AFDB:A3E0T0	0.304	0.367	3.505E-28	870	0.166	0.201	A3E0T0.pdb.gz	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
11	PDB:4rm8A	0.248	0.682	1.044E-16	368	0.075	0.215	4rm8A.pdb.gz
12	PDB:7rx9A	0.182	0.402	2.575E-13	432	0.083	0.201	7rx9A.pdb.gz
13	PDB:4mt6A	0.218	0.488	2.810E-12	389	0.072	0.195	4mt6A.pdb.gz
14	PDB:4gouA	0.225	0.425	1.158E-7	507	0.041	0.085	4gouA.pdb.gz
15	PDB:3ljuX	0.097	0.246	1.112E-6	373	0.043	0.121	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
16	PDB:7c3mA	0.214	0.376	6.693E-5	577	0.052	0.095	7c3mA.pdb.gz
17	PDB:5yqrA	0.098	0.336	2.307E-4	268	0.028	0.108	5yqrA.pdb.gz
18	PDB:6bbpA	0.087	0.171	6.158E-4	520	0.051	0.104	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:6u3eA	0.096	0.220	1.072E-3	397	0.061	0.161	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:4mk0A	0.093	0.150	1.575E-3	631	0.033	0.055	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QIC8	0.0	1080	1025	0.529	0.544	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
2	F1LYQ8	0.0	1142	1049	0.543	0.545	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
3	O94887	0.0	2189	1054	1.000	1.000	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
4	Q91VS8	0.0	1785	1065	0.833	0.824	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
5	Q9Y4F1	0.0	1111	1045	0.547	0.552	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
6	Q6ZUT3	1.22e-123	396	714	0.177	0.262	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
7	A2AD83	5.15e-121	389	703	0.177	0.266	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
8	O17905	1.59e-89	313	1091	0.148	0.143	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
9	X6R7S7	2.63e-80	276	594	0.123	0.219	X6R7S7_HUMAN FERM domain containing 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=4 SV=1
10	P29074	2.25e-79	281	926	0.163	0.186	PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens OX=9606 GN=PTPN4 PE=1 SV=1
11	Q9WU22	2.05e-77	275	926	0.166	0.189	PTN4_MOUSE Tyrosine-protein phosphatase non-receptor type 4 OS=Mus musculus OX=10090 GN=Ptpn4 PE=1 SV=2
12	A8K968	9.76e-73	259	756	0.133	0.185	A8K968_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
13	E9PII3	9.97e-73	258	706	0.136	0.203	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
14	A0A8I5ZZJ7	1.68e-72	259	835	0.134	0.169	A0A8I5ZZJ7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
15	A0A8I5ZVK0	3.06e-72	260	888	0.134	0.159	A0A8I5ZVK0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
16	A0A2R8Y5B3	3.43e-72	258	824	0.139	0.177	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
17	A3E0T0	3.83e-72	259	870	0.134	0.162	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
18	F7FPP7	3.99e-72	260	911	0.134	0.155	F7FPP7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
19	A0A0A0MRA8	4.06e-72	260	918	0.134	0.154	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
20	A0A8I6AUN0	4.08e-72	260	902	0.134	0.156	A0A8I6AUN0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03704 BTAD	1.9e+02	13.8	Bacterial transcriptional activator domain
2	PF08736 FA	1.6e-11	55.4	FERM adjacent (FA)
3	PF09380 FERM_C	1.9e-21	87.6	FERM C-terminal PH-like domain
4	PF00373 FERM_M	1.1e-09	50.1	FERM central domain
5	PF09379 FERM_N	1.8e-19	80.7	FERM N-terminal domain
6	PF16453 IQ_SEC7_PH	2.7	19.3	PH domain
7	PF00169 PH	5e-22	89.8	PH domain
8	PF15413 PH_11	45	15.9	Pleckstrin homology domain
9	PF16652 PH_13	0.018	26.4	Pleckstrin homology domain
10	PF00621 RhoGEF	1.7e-36	137.7	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377061	0.983	Plexin-A1
2	9606.ENSP00000383118	0.926	Cell division control protein 42 homolog
3	9606.ENSP00000362680	0.924	Proto-oncogene tyrosine-protein kinase Src
4	9606.ENSP00000348461	0.907	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000250559	0.903	Ras-related protein Rap-1b
6	9606.ENSP00000358723	0.903	Ras-related protein Rap-1A
7	9606.ENSP00000265362	0.869	Semaphorin-3A
8	9606.ENSP00000352882	0.862	Plexin-A4
9	9606.ENSP00000466363	0.800	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
10	9606.ENSP00000356000	0.742	Plexin-A2
11	9606.ENSP00000331504	0.726	Tyrosine-protein kinase Fes/Fps
12	9606.ENSP00000358696	0.724	Plexin-A3
13	9606.ENSP00000316029	0.669	Talin-1
14	9606.ENSP00000265371	0.666	Neuropilin-1
15	9606.ENSP00000346671	0.661	Tyrosine-protein kinase Fyn
16	9606.ENSP00000308893	0.609	Sushi, nidogen and EGF-like domain-containing protein 1
17	9606.ENSP00000373586	0.606	Uncharacterized protein C2orf54
18	9606.ENSP00000385006	0.606	THAP domain containing 4
19	9606.ENSP00000385887	0.606	Ankyrin repeat and MYND domain containing 1
20	9606.ENSP00000246792	0.601	Ras-related protein R-Ras

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0051716	0.945	cellular response to stimulus
GO:0048856	0.944	anatomical structure development
GO:0032501	0.939	multicellular organismal process
GO:0007165	0.880	signal transduction
GO:0030154	0.851	cell differentiation
GO:0048468	0.840	cell development
GO:0007275	0.707	multicellular organism development
GO:0048731	0.609	system development
GO:0071840	0.407	cellular component organization or biogenesis
GO:0035556	0.388	intracellular signal transduction
GO:0016043	0.370	cellular component organization
GO:0007399	0.340	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.776	membrane
GO:0043226	0.769	organelle
GO:0005886	0.768	plasma membrane
GO:0043229	0.594	intracellular organelle
GO:0043231	0.365	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]