StarFunc result for job id O94898

User Input

>input (1065 residues)
MAPAPLGVPEEQLLGCRSRVLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDFSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRMSMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNN
AIMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQ
SILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEIL
YDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNE
MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIY
LNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRV
ICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESL
IPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESP
QLHQNEGLAGREPDCSASSMSCHRLQDHAFDFSRTRNIQDGSEGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94898	1.000	1.000	0.000	1065	1.000	1.000	O94898.pdb.gz	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
2	AFDB:Q6P1C6	0.650	0.623	0.000	1117	0.563	0.537	Q6P1C6.pdb.gz	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
3	AFDB:Q6UXM1	0.674	0.643	0.000	1119	0.574	0.546	Q6UXM1.pdb.gz	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
4	AFDB:Q96JA1	0.637	0.622	7.747E-95	1093	0.483	0.470	Q96JA1.pdb.gz	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
5	AFDB:A0A2R8QRK0	0.155	0.118	2.365E-18	1420	0.117	0.088	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
6	AFDB:P13595	0.198	0.190	1.431E-16	1115	0.101	0.097	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
7	AFDB:E7FBY6	0.149	0.120	4.372E-15	1367	0.147	0.115	E7FBY6.pdb.gz	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
8	PDB:6dldD	0.207	0.696	5.785E-15	269	0.059	0.234	6dldD.pdb.gz
9	AFDB:Q90X22	0.094	0.079	1.139E-14	1276	0.074	0.062	Q90X22.pdb.gz
10	AFDB:Q0KIB0	0.154	0.108	1.165E-13	1689	0.082	0.052	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
11	AFDB:Q80TH2	0.270	0.209	2.646E-13	1402	0.127	0.096	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
12	PDB:6dlfA	0.178	0.647	9.121E-13	236	0.060	0.271	6dlfA.pdb.gz
13	PDB:7wv3A	0.171	0.236	1.095E-12	668	0.109	0.174	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:3t6qA	0.262	0.427	9.764E-12	601	0.103	0.183	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:5oj2B	0.119	0.168	5.275E-11	692	0.060	0.092	5oj2B.pdb.gz
16	PDB:3b2dA	0.234	0.386	1.254E-10	601	0.107	0.190	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7tvfD	0.241	0.443	1.374E-10	515	0.093	0.192	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:7wrqA	0.283	0.489	2.375E-10	566	0.129	0.242	7wrqA.pdb.gz
19	PDB:1xcdA	0.218	0.666	4.495E-10	305	0.077	0.269	1xcdA.pdb.gz
20	PDB:6gffI	0.240	0.428	4.924E-10	551	0.103	0.200	6gffI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94898	0.0	2209	1065	1.000	1.000	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
2	P70193	0.0	887	1091	0.441	0.431	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2
3	Q52KR2	0.0	1924	1054	0.896	0.905	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
4	Q6P1C6	0.0	1135	1117	0.532	0.508	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
5	Q6UXM1	0.0	1139	1119	0.549	0.523	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
6	Q96JA1	0.0	887	1093	0.466	0.454	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
7	Q965M2	4.73e-95	324	881	0.205	0.247	SMA10_CAEEL Leucine-rich repeats and immunoglobulin-like domains protein sma-10 OS=Caenorhabditis elegans OX=6239 GN=sma-10 PE=1 SV=1
8	Q3UQ28	1.14e-52	204	1475	0.140	0.101	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
9	Q92626	1.12e-50	198	1479	0.139	0.100	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
10	Q9NT99	5.21e-35	145	713	0.118	0.177	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
11	P0C192	9.53e-35	145	709	0.118	0.178	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
12	P0CC10	1.21e-34	144	709	0.118	0.178	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
13	Q149C3	1.73e-34	142	593	0.132	0.238	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
14	Q9DBB9	6.96e-33	137	547	0.113	0.219	CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus OX=10090 GN=Cpn2 PE=1 SV=2
15	Q9VZZ4	9.70e-33	140	1527	0.120	0.084	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
16	Q3URE9	3.20e-32	135	606	0.156	0.274	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
17	A0A0A0MSX4	5.74e-32	137	1531	0.084	0.058	A0A0A0MSX4_HUMAN Roundabout guidance receptor 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
18	Q9Y6N7	6.16e-32	137	1651	0.084	0.054	ROBO1_HUMAN Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
19	O89026	6.67e-32	137	1612	0.084	0.055	ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1
20	Q9HBX8	1.86e-31	135	967	0.118	0.130	LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens OX=9606 GN=LGR6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.4e+02	13.5	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.1e-05	35.2	CD80-like C2-set immunoglobulin domain
3	PF16013 DUF4781	3.7e+02	11.3	Domain of unknown function (DUF4781)
4	PF07679 I-set	6.7e-44	159.2	Immunoglobulin I-set domain
5	PF00047 ig	2e-22	90.5	Immunoglobulin domain
6	PF13895 Ig_2	7.9e-27	104.7	Immunoglobulin domain
7	PF13927 Ig_3	2.3e-39	145.1	Immunoglobulin domain
8	PF16681 Ig_5	0.00047	31.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF01463 LRRCT	1.8	20.3	Leucine rich repeat C-terminal domain
10	PF00560 LRR_1	1.2e-06	38.9	Leucine Rich Repeat
11	PF12799 LRR_4	1e-27	106.9	Leucine Rich repeats (2 copies)
12	PF13306 LRR_5	1.8e-27	107.2	BspA type Leucine rich repeat region (6 copies)
13	PF13516 LRR_6	0.029	25.5	Leucine Rich repeat
14	PF13855 LRR_8	2.7e-71	246.5	Leucine rich repeat
15	PF14580 LRR_9	8.9e-08	43.4	Leucine-rich repeat
16	PF16101 PRIMA1	8.3e+02	11.5	Proline-rich membrane anchor 1
17	PF07686 V-set	1.1e-09	49.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355396

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359583	0.842	Inactive heparanase-2
2	9606.ENSP00000222572	0.816	Serum paraoxonase/arylesterase 2
3	9606.ENSP00000275493	0.690	Epidermal growth factor receptor
4	9606.ENSP00000369346	0.664	Arylsulfatase family member K
5	9606.ENSP00000262932	0.637	Protein canopy homolog 4
6	9606.ENSP00000273261	0.637	Leucine-rich repeats and immunoglobulin-like domains protein 1
7	9606.ENSP00000385735	0.620	Galactosylceramide sulfotransferase
8	9606.ENSP00000217402	0.598	Charged multivesicular body protein 4b
9	9606.ENSP00000361926	0.576	Protein canopy homolog 3
10	9606.ENSP00000264249	0.558	Carbohydrate sulfotransferase 10
11	9606.ENSP00000452126	0.556	Repulsive guidance molecule A
12	9606.ENSP00000357633	0.519	Glutaredoxin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.502	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.970	cellular process
GO:0032502	0.911	developmental process
GO:0048856	0.894	anatomical structure development
GO:0032501	0.871	multicellular organismal process
GO:0007275	0.793	multicellular organism development
GO:0008152	0.748	metabolic process
GO:0019222	0.714	regulation of metabolic process
GO:0071704	0.665	organic substance metabolic process
GO:0051171	0.655	regulation of nitrogen compound metabolic process
GO:0080090	0.641	regulation of primary metabolic process
GO:0060255	0.634	regulation of macromolecule metabolic process
GO:0048518	0.590	positive regulation of biological process
GO:0048731	0.560	system development
GO:0044238	0.557	primary metabolic process
GO:0006807	0.516	nitrogen compound metabolic process
GO:0048523	0.516	negative regulation of cellular process
GO:0048522	0.511	positive regulation of cellular process
GO:0048583	0.496	regulation of response to stimulus
GO:0043170	0.493	macromolecule metabolic process
GO:0031323	0.462	regulation of cellular metabolic process
GO:0050896	0.453	response to stimulus
GO:0023051	0.450	regulation of signaling
GO:0010646	0.448	regulation of cell communication
GO:0007399	0.435	nervous system development
GO:0071840	0.405	cellular component organization or biogenesis
GO:0009966	0.339	regulation of signal transduction
GO:0019538	0.336	protein metabolic process
GO:0009893	0.308	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.996	organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0005622	0.985	intracellular anatomical structure
GO:0016020	0.981	membrane
GO:0043229	0.959	intracellular organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0071944	0.932	cell periphery
GO:0005737	0.907	cytoplasm
GO:0005886	0.906	plasma membrane
GO:0005576	0.656	extracellular region
GO:0042995	0.441	cell projection
GO:0120025	0.418	plasma membrane bounded cell projection
GO:0031982	0.334	vesicle
GO:0012505	0.325	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]