StarFunc result for job id O94900

User Input

>input (526 residues)
MDVRFYPPPAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPG
PSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITV
SNMLGQDGTLLSNSISVMPDIRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLT
TINQSQLSAQLGLNMGGSNVPHNSPSPPGSKSATPSPSSSVHEDEGDDTSKINGGEKRPA
SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWD
GLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQLINSKPSVFH
GPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP
LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTS
TAAQVVTQAMEYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94900	0.999	0.999	2.527E-70	526	1.000	1.000	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
2	AFDB:O94842	0.218	0.186	2.764E-17	621	0.346	0.293	O94842.pdb.gz	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
3	AFDB:A0A2R8QK93	0.152	0.105	1.896E-7	774	0.120	0.081	A0A2R8QK93.pdb.gz
4	AFDB:Q9HCS4	0.134	0.121	1.249E-5	588	0.167	0.150	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
5	PDB:1j5nA	0.132	0.588	1.446E-4	93	0.063	0.355	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
6	AFDB:B7WNT5	0.129	0.140	4.949E-4	481	0.122	0.133	B7WNT5.pdb.gz	B7WNT5_HUMAN Transcription factor 7 OS=Homo sapiens OX=9606 GN=TCF7 PE=1 SV=1
7	AFDB:O18400	0.083	0.085	2.744E-3	509	0.135	0.139	O18400.pdb.gz	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
8	AFDB:P09085	0.070	0.082	3.537E-3	427	0.118	0.145	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
9	AFDB:Q8I4M5	0.087	0.046	4.558E-3	1052	0.129	0.065	Q8I4M5.pdb.gz	GLS1_CAEEL Germline survival defective-1 OS=Caenorhabditis elegans OX=6239 GN=gls-1 PE=1 SV=2
10	AFDB:P91943	0.136	0.104	1.961E-2	751	0.158	0.111	P91943.pdb.gz	PANG1_DROME Protein pangolin, isoforms A/H/I/S OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=1
11	AFDB:Q01593	0.083	0.066	4.474E-2	720	0.156	0.114	Q01593.pdb.gz	ABI3_ARATH B3 domain-containing transcription factor ABI3 OS=Arabidopsis thaliana OX=3702 GN=ABI3 PE=1 SV=1
12	PDB:7k98A	0.079	0.112	1.963	343	0.038	0.058	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
13	PDB:3pcoC	0.070	0.101	2.229	323	0.025	0.040	3pcoC.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
14	PDB:4i9qB	0.068	0.046	2.375	873	0.013	0.008	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
15	PDB:7nsuD	0.076	0.093	2.873	420	0.025	0.031	7nsuD.pdb.gz
16	PDB:1kw2A	0.062	0.072	3.061	455	0.015	0.018	1kw2A.pdb.gz
17	PDB:2wpdJ	0.061	0.230	3.475	76	0.017	0.118	2wpdJ.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
18	PDB:1lotA	0.062	0.074	3.703	436	0.015	0.018	1lotA.pdb.gz	Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
19	PDB:2b5uA	0.076	0.084	3.703	470	0.029	0.032	2b5uA.pdb.gz
20	PDB:2pe4A	0.049	0.062	3.703	417	0.008	0.010	2pe4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94900	0.0	1074	526	1.000	1.000	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
2	Q66JW3	0.0	912	526	0.943	0.943	TOX_MOUSE Thymocyte selection-associated high mobility group box protein TOX OS=Mus musculus OX=10090 GN=Tox PE=1 SV=2
3	O15405	7.91e-97	306	576	0.426	0.389	TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=2
4	B7SBD2	3.02e-94	300	577	0.433	0.395	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
5	Q80W03	8.58e-93	296	575	0.432	0.395	TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus OX=10090 GN=Tox3 PE=1 SV=1
6	Q76IQ7	2.72e-83	268	473	0.342	0.381	TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus OX=10116 GN=Tox2 PE=2 SV=1
7	O94842	1.20e-67	231	621	0.285	0.242	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
8	H3BTZ9	5.00e-17	80.9	166	0.133	0.422	H3BTZ9_HUMAN TOX high mobility group box family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=1
9	P11633	3.55e-15	73.6	99	0.070	0.374	NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6B PE=1 SV=3
10	B4UN11	3.80e-14	70.1	93	0.057	0.323	B4UN11_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08541g PE=4 SV=1
11	P07746	1.44e-11	65.9	204	0.065	0.167	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
12	Q08943	2.02e-11	68.9	708	0.068	0.051	SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus OX=10090 GN=Ssrp1 PE=1 SV=2
13	P11632	5.24e-11	61.2	93	0.065	0.366	NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6A PE=1 SV=1
14	Q9YH06	1.67e-10	63.2	215	0.070	0.172	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
15	P09429	1.79e-10	63.2	215	0.070	0.172	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
16	P10103	1.79e-10	63.2	215	0.070	0.172	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
17	P63158	1.79e-10	63.2	215	0.070	0.172	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
18	P63159	1.79e-10	63.2	215	0.070	0.172	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
19	F2Z594	1.82e-10	63.2	220	0.070	0.168	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
20	Q08945	1.96e-10	65.9	709	0.061	0.045	SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	4.7e-14	63.9	HMG (high mobility group) box
2	PF09011 HMG_box_2	3.8e-08	45.1	HMG-box domain
3	PF04690 YABBY	94	15.0	YABBY protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355204	0.729	Protein FAM110B
2	9606.ENSP00000427820	0.643	Uncharacterized protein C8orf34
3	9606.ENSP00000302260	0.540	Uncharacterized protein C8orf46
4	9606.ENSP00000342681	0.539	T-cell surface glycoprotein CD5
5	9606.ENSP00000479745	0.537	Serine protease 56
6	9606.ENSP00000406286	0.533	Zinc finger and BTB domain-containing protein 7B
7	9606.ENSP00000216297	0.518	FACT complex subunit SPT16
8	9606.ENSP00000390084	0.517	Protein shisa-6 homolog
9	9606.ENSP00000260130	0.501	Syntenin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.954	DNA binding
GO:0043565	0.603	sequence-specific DNA binding
GO:0140110	0.480	transcription regulator activity
GO:1990837	0.447	sequence-specific double-stranded DNA binding
GO:0000976	0.376	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0032502	0.989	developmental process
GO:0009987	0.986	cellular process
GO:0048856	0.972	anatomical structure development
GO:0065007	0.966	biological regulation
GO:0050794	0.955	regulation of cellular process
GO:0002376	0.933	immune system process
GO:0030097	0.919	hemopoiesis
GO:0001775	0.904	cell activation
GO:0002521	0.894	leukocyte differentiation
GO:0046649	0.885	lymphocyte activation
GO:1903131	0.856	mononuclear cell differentiation
GO:0019222	0.743	regulation of metabolic process
GO:0060255	0.712	regulation of macromolecule metabolic process
GO:0048518	0.674	positive regulation of biological process
GO:0030098	0.643	lymphocyte differentiation
GO:0048522	0.613	positive regulation of cellular process
GO:0080090	0.600	regulation of primary metabolic process
GO:0051171	0.600	regulation of nitrogen compound metabolic process
GO:0031323	0.583	regulation of cellular metabolic process
GO:0019219	0.443	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0010468	0.370	regulation of gene expression
GO:0031325	0.366	positive regulation of cellular metabolic process
GO:0051173	0.361	positive regulation of nitrogen compound metabolic process
GO:0007275	0.356	multicellular organism development
GO:0051252	0.337	regulation of RNA metabolic process
GO:0031326	0.336	regulation of cellular biosynthetic process
GO:0010556	0.335	regulation of macromolecule biosynthetic process
GO:1903506	0.309	regulation of nucleic acid-templated transcription
GO:0006355	0.301	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.967	nucleoplasm
GO:0005737	0.372	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]