StarFunc result for job id O94905

User Input

>input (339 residues)
MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BFZ9	0.860	0.858	9.781E-54	340	0.976	0.974	Q8BFZ9.pdb.gz	ERLN2_MOUSE Erlin-2 OS=Mus musculus OX=10090 GN=Erlin2 PE=1 SV=1
2	AFDB:O75477	0.847	0.826	2.219E-45	348	0.735	0.716	O75477.pdb.gz	ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2
3	AFDB:A3QMC6	0.835	0.904	2.183E-40	312	0.584	0.635	A3QMC6.pdb.gz	ERLN_CAEEL Erlin OS=Caenorhabditis elegans OX=6239 GN=erl-1 PE=1 SV=1
4	AFDB:Q9ZQ87	0.719	0.687	2.023E-35	356	0.504	0.480	Q9ZQ87.pdb.gz	Q9ZQ87_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=1 SV=2
5	AFDB:Q0PBN7	0.563	0.531	2.132E-15	362	0.159	0.149	Q0PBN7.pdb.gz	Q0PBN7_CAMJE Transmembrane protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj0268c PE=4 SV=1
6	AFDB:P9WPR9	0.530	0.481	2.263E-15	381	0.218	0.194	P9WPR9.pdb.gz	Y1488_MYCTU Uncharacterized protein Rv1488 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1488 PE=1 SV=1
7	AFDB:O94550	0.458	0.530	3.644E-15	288	0.147	0.174	O94550.pdb.gz	PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb2 PE=1 SV=2
8	AFDB:Q9P7H3	0.446	0.525	4.625E-15	282	0.153	0.184	Q9P7H3.pdb.gz	PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb1 PE=3 SV=1
9	AFDB:Q9SIL6	0.532	0.617	4.908E-15	286	0.133	0.157	Q9SIL6.pdb.gz	PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB6 PE=1 SV=1
10	AFDB:O49460	0.530	0.611	5.210E-15	288	0.127	0.149	O49460.pdb.gz	PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB1 PE=1 SV=1
11	PDB:7vhpG	0.418	0.465	2.581E-14	299	0.162	0.184	7vhpG.pdb.gz
12	PDB:7wi3B	0.412	0.487	9.989E-9	275	0.147	0.182	7wi3B.pdb.gz
13	PDB:4v60A	0.382	0.177	6.859E-7	812	0.177	0.074	4v60A.pdb.gz
14	PDB:1nrgA	0.097	0.136	3.576E-1	213	0.035	0.056	1nrgA.pdb.gz	Structure and properties of recombinant human pyridoxine 5'-phosphate oxidase.
15	PDB:4bqfB	0.096	0.047	7.757E-1	827	0.056	0.023	4bqfB.pdb.gz	Sugar-Coated Sensor Chip and Nanoparticle Surfaces for the in Vitro Enzymatic Synthesis of Starch-Like Materials
16	PDB:5dykA	0.060	0.040	8.233E-1	809	0.050	0.021	5dykA.pdb.gz
17	PDB:5nf4A	0.068	0.075	8.738E-1	295	0.018	0.020	5nf4A.pdb.gz
18	PDB:7r5jH0	0.093	0.083	9.275E-1	383	0.133	0.117	7r5jH0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:2pl5A	0.069	0.066	1.045	362	0.006	0.006	2pl5A.pdb.gz
20	PDB:3upuA	0.046	0.038	1.109	439	0.029	0.023	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384ME54	0.0	696	339	1.000	1.000	A0A384ME54_HUMAN Erlin OS=Homo sapiens OX=9606 PE=2 SV=1
2	E5RHW4	0.0	694	338	0.997	1.000	E5RHW4_HUMAN Erlin (Fragment) OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1
3	O75477	0.0	508	348	0.711	0.693	ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2
4	O94905	0.0	696	339	1.000	1.000	ERLN2_HUMAN Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1
5	Q8BFZ9	0.0	677	340	0.976	0.974	ERLN2_MOUSE Erlin-2 OS=Mus musculus OX=10090 GN=Erlin2 PE=1 SV=1
6	A3QMC6	1.43e-144	412	312	0.581	0.631	ERLN_CAEEL Erlin OS=Caenorhabditis elegans OX=6239 GN=erl-1 PE=1 SV=1
7	Q9ZQ87	2.17e-122	358	356	0.496	0.472	Q9ZQ87_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g03510 PE=1 SV=2
8	A0A1D8PTU3	0.003	41.6	350	0.136	0.131	A0A1D8PTU3_CANAL Band 7 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLP3 PE=3 SV=1
9	P9WPR9	0.049	37.7	381	0.230	0.205	Y1488_MYCTU Uncharacterized protein Rv1488 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1488 PE=1 SV=1
10	Q91X05	0.75	33.9	385	0.156	0.138	PODO_MOUSE Podocin OS=Mus musculus OX=10090 GN=Nphs2 PE=1 SV=2
11	P0ABC3	1.2	33.1	334	0.047	0.048	HFLC_ECOLI Modulator of FtsH protease HflC OS=Escherichia coli (strain K12) OX=83333 GN=hflC PE=1 SV=1
12	Q99MY8	1.4	33.5	2958	0.065	0.007	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
13	Q382P4	1.8	33.1	1299	0.088	0.023	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
14	Q9NP85	2.1	32.7	383	0.056	0.050	PODO_HUMAN Podocin OS=Homo sapiens OX=9606 GN=NPHS2 PE=1 SV=1
15	Q9UPQ4	2.9	32.3	493	0.124	0.085	TRI35_HUMAN E3 ubiquitin-protein ligase TRIM35 OS=Homo sapiens OX=9606 GN=TRIM35 PE=1 SV=2
16	Q99551	5.8	31.2	399	0.074	0.063	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
17	B4DPR9	7.0	30.8	379	0.074	0.066	B4DPR9_HUMAN Mitochondrial transcription termination factor 1 OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
18	Q9VA48	7.0	31.2	649	0.065	0.034	Q9VA48_DROME Serpin 100A OS=Drosophila melanogaster OX=7227 GN=Spn100A PE=1 SV=1
19	E1JHN2	7.2	30.8	289	0.083	0.097	E1JHN2_DROME Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=3 SV=1
20	Q5BIB9	7.2	30.8	297	0.083	0.094	Q5BIB9_DROME RE17490p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	3.9e-16	71.1	SPFH domain / Band 7 family
2	PF14251 DUF4346	3.2e+02	12.7	Domain of unknown function (DUF4346)
3	PF01855 POR_N	8.3e+02	11.1	Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg
4	PF12137 RapA_C	2.9e+02	11.8	RNA polymerase recycling family C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290649	0.983	E3 ubiquitin-protein ligase AMFR
2	9606.ENSP00000410964	0.975	Erlin-1
3	9606.ENSP00000479488	0.949	Prohibitin
4	9606.ENSP00000328551	0.945	Ras-related protein Rab-28
5	9606.ENSP00000306253	0.930	Inositol 1,4,5-trisphosphate receptor type 1
6	9606.ENSP00000256078	0.900	GTPase KRas
7	9606.ENSP00000358548	0.900	GTPase NRas
8	9606.ENSP00000407586	0.900	GTPase HRas
9	9606.ENSP00000333551	0.887	Pyridoxal phosphate homeostasis protein
10	9606.ENSP00000344741	0.872	Insulin-induced gene 1 protein
11	9606.ENSP00000332325	0.829	Zinc finger protein 703
12	9606.ENSP00000445725	0.814	E3 ubiquitin-protein ligase RNF170
13	9606.ENSP00000320508	0.806	E3 ubiquitin-protein ligase RNF185
14	9606.ENSP00000003084	0.786	Cystic fibrosis transmembrane conductance regulator
15	9606.ENSP00000318165	0.769	Protein OS-9
16	9606.ENSP00000366395	0.754	E3 ubiquitin-protein ligase synoviolin
17	9606.ENSP00000364235	0.736	E3 ubiquitin-protein ligase RNF5
18	9606.ENSP00000259512	0.729	Derlin-1
19	9606.ENSP00000286713	0.725	Erythrocyte band 7 integral membrane protein
20	9606.ENSP00000351777	0.719	Transitional endoplasmic reticulum ATPase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.355	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:1901698	0.995	response to nitrogen compound
GO:0050794	0.995	regulation of cellular process
GO:0036503	0.991	ERAD pathway
GO:0019222	0.981	regulation of metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0048519	0.965	negative regulation of biological process
GO:0030433	0.958	ubiquitin-dependent ERAD pathway
GO:0007154	0.954	cell communication
GO:0019216	0.952	regulation of lipid metabolic process
GO:0048523	0.945	negative regulation of cellular process
GO:0009892	0.945	negative regulation of metabolic process
GO:0019218	0.943	regulation of steroid metabolic process
GO:0007165	0.942	signal transduction
GO:0042304	0.930	regulation of fatty acid biosynthetic process
GO:0031327	0.915	negative regulation of cellular biosynthetic process
GO:0062014	0.910	negative regulation of small molecule metabolic process
GO:1902930	0.889	regulation of alcohol biosynthetic process
GO:0050810	0.889	regulation of steroid biosynthetic process
GO:0090181	0.888	regulation of cholesterol metabolic process
GO:0006984	0.888	ER-nucleus signaling pathway
GO:0051055	0.871	negative regulation of lipid biosynthetic process
GO:0045922	0.871	negative regulation of fatty acid metabolic process
GO:0106118	0.372	regulation of sterol biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005829	0.998	cytosol
GO:0005886	0.997	plasma membrane
GO:0031090	0.851	organelle membrane
GO:0098827	0.734	endoplasmic reticulum subcompartment
GO:0005789	0.723	endoplasmic reticulum membrane
GO:0032991	0.588	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]