StarFunc result for job id O94906

User Input

>input (941 residues)
MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQM
KKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR
EQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLT
PVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKS
VRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKA
VVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR
IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRK
HTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRA
VAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYER
ARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLW
LESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHD
PHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
CESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94906	1.000	1.000	0.000	941	1.000	1.000	O94906.pdb.gz	PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1
2	AFDB:Q9ZT71	0.716	0.655	5.950E-68	1029	0.540	0.494	Q9ZT71.pdb.gz	STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana OX=3702 GN=STA1 PE=1 SV=1
3	AFDB:Q12381	0.706	0.732	8.473E-62	906	0.460	0.478	Q12381.pdb.gz	PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp1 PE=1 SV=1
4	PDB:5o9zG	0.514	0.585	2.567E-56	804	0.852	0.998	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
5	PDB:6ah0N	0.236	0.372	6.524E-30	579	0.600	0.976	6ah0N.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
6	PDB:5nrlJ	0.519	0.592	1.316E-26	800	0.238	0.280	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
7	AFDB:Q381L7	0.351	0.330	1.023E-19	1009	0.183	0.170	Q381L7.pdb.gz	Q381L7_TRYB2 PRP1 splicing factor N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7330 PE=4 SV=1
8	AFDB:Q9BZJ0	0.187	0.205	7.830E-15	848	0.160	0.178	Q9BZJ0.pdb.gz	CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4
9	AFDB:F4JZX8	0.212	0.267	3.507E-14	705	0.128	0.170	F4JZX8.pdb.gz	F4JZX8_ARATH Crooked neck protein, putative / cell cycle protein OS=Arabidopsis thaliana OX=3702 GN=At5g41770 PE=1 SV=1
10	AFDB:Q9Y5Q9	0.176	0.185	1.631E-13	886	0.118	0.125	Q9Y5Q9.pdb.gz	TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3 PE=1 SV=1
11	AFDB:Q6NNB2	0.193	0.158	2.120E-13	1233	0.109	0.084	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
12	AFDB:Q9FNM3	0.218	0.288	2.120E-13	673	0.120	0.168	Q9FNM3.pdb.gz	Q9FNM3_ARATH CRN (Crooked neck) protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.3 PE=1 SV=1
13	AFDB:A0A2R8PZ91	0.198	0.171	3.084E-13	1119	0.108	0.091	A0A2R8PZ91.pdb.gz
14	PDB:4bujB	0.187	0.136	5.770E-13	1367	0.099	0.068	4bujB.pdb.gz
15	PDB:3jcmG	0.345	0.408	1.091E-12	734	0.185	0.237	3jcmG.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:7qdrB	0.229	0.189	2.641E-11	1212	0.111	0.086	7qdrB.pdb.gz
17	PDB:6tedQ	0.192	0.201	1.999E-10	890	0.099	0.104	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:6bq1B	0.190	0.232	2.411E-10	728	0.111	0.143	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
19	PDB:7dkhI	0.210	0.215	2.503E-10	914	0.098	0.101	7dkhI.pdb.gz
20	PDB:7ntfA	0.195	0.200	3.134E-10	918	0.077	0.078	7ntfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94906	0.0	1946	941	1.000	1.000	PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1
2	Q12381	0.0	853	906	0.462	0.480	PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp1 PE=1 SV=1
3	Q9VVU6	0.0	1393	931	0.711	0.719	Q9VVU6_DROME Pre-mRNA-processing factor 6 OS=Drosophila melanogaster OX=7227 GN=Prp6 PE=1 SV=2
4	Q9ZT71	0.0	981	1029	0.544	0.498	STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana OX=3702 GN=STA1 PE=1 SV=1
5	P19735	1.87e-98	331	899	0.276	0.289	PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP6 PE=1 SV=1
6	Q8SX58	6.39e-66	219	143	0.105	0.692	Q8SX58_DROME LD43276p OS=Drosophila melanogaster OX=7227 GN=Prp6 PE=2 SV=1
7	P63155	4.94e-17	88.6	690	0.129	0.175	CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus OX=10116 GN=Crnkl1 PE=2 SV=1
8	Q9BZJ0	1.80e-16	87.0	848	0.120	0.133	CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4
9	F4JZX8	9.80e-15	80.9	705	0.105	0.140	F4JZX8_ARATH Crooked neck protein, putative / cell cycle protein OS=Arabidopsis thaliana OX=3702 GN=At5g41770 PE=1 SV=1
10	Q54XP4	8.17e-13	74.7	705	0.108	0.145	CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum OX=44689 GN=crnkl1 PE=3 SV=1
11	P87312	1.04e-11	71.2	674	0.111	0.154	CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf4 PE=1 SV=1
12	P17886	1.59e-10	67.4	702	0.112	0.150	CRN_DROME Protein crooked neck OS=Drosophila melanogaster OX=7227 GN=crn PE=2 SV=2
13	Q8RWG2	5.17e-09	62.4	652	0.071	0.103	CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana OX=3702 GN=HCF107 PE=1 SV=1
14	Q9FNM3	5.89e-09	62.4	673	0.111	0.155	Q9FNM3_ARATH CRN (Crooked neck) protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.3 PE=1 SV=1
15	F4J8K6	6.42e-07	56.2	1920	0.054	0.027	RRP5_ARATH rRNA biogenesis protein RRP5 OS=Arabidopsis thaliana OX=3702 GN=RRP5 PE=2 SV=2
16	Q38A09	2.53e-05	50.4	776	0.044	0.053	Q38A09_TRYB2 Crooked neck protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0680 PE=4 SV=1
17	Q381L7	3.80e-05	50.1	1009	0.064	0.059	Q381L7_TRYB2 PRP1 splicing factor N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7330 PE=4 SV=1
18	Q9LKU3	7.02e-05	49.3	917	0.084	0.086	Q9LKU3_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T32B20.g PE=1 SV=1
19	Q86UA1	9.65e-05	48.5	669	0.095	0.133	PRP39_HUMAN Pre-mRNA-processing factor 39 OS=Homo sapiens OX=9606 GN=PRPF39 PE=1 SV=3
20	Q9P7R9	1.58e-04	48.1	790	0.098	0.116	SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09295 ChAPs	21	15.6	ChAPs (Chs5p-Arf1p-binding proteins)
2	PF10300 Iml2-TPR_39	30	14.8	Iml2/Tetratricopeptide repeat protein 39
3	PF02566 OsmC	6.2e+02	12.3	OsmC-like protein
4	PF06424 PRP1_N	1.6e-52	189.2	PRP1 splicing factor, N-terminal
5	PF05843 Suf	0.00017	33.3	Suppressor of forked protein (Suf)
6	PF00515 TPR_1	0.064	24.3	Tetratricopeptide repeat
7	PF13428 TPR_14	2.8e-28	107.0	Tetratricopeptide repeat
8	PF13432 TPR_16	0.0035	29.2	Tetratricopeptide repeat
9	PF13431 TPR_17	7.4e-07	40.2	Tetratricopeptide repeat
10	PF14559 TPR_19	2.2e-16	71.4	Tetratricopeptide repeat
11	PF07719 TPR_2	1.1e-05	36.2	Tetratricopeptide repeat
12	PF09976 TPR_21	32	15.7	Tetratricopeptide repeat-like domain
13	PF13174 TPR_6	3.5	19.6	Tetratricopeptide repeat
14	PF13181 TPR_8	0.00035	31.6	Tetratricopeptide repeat
15	PF13371 TPR_9	6.9	18.2	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000016478

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005082	0.999	Small nuclear ribonucleoprotein 200kDa (U5)
2	9593.ENSGGOP00000005173	0.999	Plays role in pre-mRNA splicing.
3	9593.ENSGGOP00000009241	0.999	SART1, U4/U6.U5 tri-snRNP-associated protein 1
4	9593.ENSGGOP00000012672	0.999	Elongation factor Tu GTP binding domain containing 2
5	9593.ENSGGOP00000016115	0.999	pre-mRNA processing factor 31
6	9593.ENSGGOP00000018201	0.999	pre-mRNA processing factor 8
7	9593.ENSGGOP00000006800	0.995	pre-mRNA processing factor 4
8	9593.ENSGGOP00000009066	0.992	Splicing factor 3b, subunit 1, 155kDa
9	9593.ENSGGOP00000012853	0.992	pre-mRNA processing factor 3
10	9593.ENSGGOP00000023410	0.982	Uncharacterized protein
11	9593.ENSGGOP00000026965	0.982	Splicing factor 3b, subunit 2, 145kDa
12	9593.ENSGGOP00000003198	0.980	Splicing factor 3b, subunit 3, 130kDa
13	9593.ENSGGOP00000015508	0.974	Small nuclear ribonucleoprotein 13
14	9593.ENSGGOP00000002381	0.973	RNA binding motif protein 25
15	9593.ENSGGOP00000011100	0.973	U6 snRNA-associated Sm-like protein LSm2
16	9593.ENSGGOP00000021953	0.969	DEAD-box helicase 23
17	9593.ENSGGOP00000023767	0.969	Uncharacterized protein
18	9593.ENSGGOP00000002313	0.963	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
19	9593.ENSGGOP00000010076	0.963	LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
20	9593.ENSGGOP00000004665	0.962	Splicing factor 3b, subunit 4, 49kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.997	RNA binding
GO:0043021	0.958	ribonucleoprotein complex binding
GO:0042802	0.942	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.997	macromolecule metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0008380	0.988	RNA splicing
GO:0016071	0.987	mRNA metabolic process
GO:0000398	0.980	mRNA splicing, via spliceosome
GO:0050789	0.937	regulation of biological process
GO:0050794	0.915	regulation of cellular process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0010468	0.877	regulation of gene expression
GO:0051171	0.876	regulation of nitrogen compound metabolic process
GO:0031323	0.875	regulation of cellular metabolic process
GO:0080090	0.873	regulation of primary metabolic process
GO:0051252	0.828	regulation of RNA metabolic process
GO:0071840	0.810	cellular component organization or biogenesis
GO:0016043	0.678	cellular component organization
GO:0048518	0.583	positive regulation of biological process
GO:0048522	0.530	positive regulation of cellular process
GO:0022607	0.521	cellular component assembly
GO:0022613	0.455	ribonucleoprotein complex biogenesis
GO:0071826	0.455	ribonucleoprotein complex subunit organization
GO:0022618	0.445	ribonucleoprotein complex assembly
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071011	1.000	precatalytic spliceosome
GO:0005654	0.999	nucleoplasm
GO:0071013	0.998	catalytic step 2 spliceosome
GO:0016020	0.986	membrane
GO:0030532	0.984	small nuclear ribonucleoprotein complex
GO:0016604	0.983	nuclear body
GO:0005684	0.976	U2-type spliceosomal complex
GO:0071005	0.891	U2-type precatalytic spliceosome
GO:0097525	0.877	spliceosomal snRNP complex
GO:0046540	0.825	U4/U6 x U5 tri-snRNP complex
GO:0016607	0.782	nuclear speck
GO:0005737	0.582	cytoplasm
GO:0005682	0.532	U5 snRNP

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]