StarFunc result for job id O94907

User Input

>input (266 residues)
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR
CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG
EGLSCRIQKDHHQASNSSRLHTCQRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94907	1.000	1.000	9.621E-54	266	1.000	1.000	O94907.pdb.gz	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
2	AFDB:A0A0B5JK99	0.449	0.490	2.702E-25	241	0.432	0.477	A0A0B5JK99.pdb.gz
3	AFDB:Q9UBT3	0.428	0.490	1.022E-21	224	0.278	0.330	Q9UBT3.pdb.gz	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
4	PDB:5irxF	0.104	0.332	3.910E-2	75	0.071	0.253	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
5	PDB:7wrqB	0.147	0.218	1.596E-1	167	0.060	0.096	7wrqB.pdb.gz
6	PDB:1la4A	0.103	0.715	3.334E-1	34	0.030	0.235	1la4A.pdb.gz
7	PDB:1g9pA	0.103	0.508	7.964E-1	45	0.053	0.311	1g9pA.pdb.gz
8	PDB:2m9lA	0.104	0.672	1.190	35	0.034	0.257	2m9lA.pdb.gz
9	PDB:2kniA	0.101	0.564	1.273	41	0.034	0.220	2kniA.pdb.gz
10	PDB:2ljsA	0.087	0.650	1.455	30	0.041	0.367	2ljsA.pdb.gz
11	AFDB:D4A1T1	0.099	0.061	1.641	474	0.165	0.093	D4A1T1.pdb.gz	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
12	PDB:7q3nU	0.116	0.110	2.326	292	0.098	0.089	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
13	PDB:1v91A	0.105	0.576	2.659	38	0.038	0.263	1v91A.pdb.gz
14	PDB:1ha9A	0.088	0.628	2.843	34	0.038	0.294	1ha9A.pdb.gz
15	AFDB:F1QKS5	0.075	0.022	5.478	1289	0.162	0.033	F1QKS5.pdb.gz
16	AFDB:Q9Y6Q2	0.074	0.033	6.698	735	0.169	0.061	Q9Y6Q2.pdb.gz	STON1_HUMAN Stonin-1 OS=Homo sapiens OX=9606 GN=STON1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94907	0.0	551	266	1.000	1.000	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
2	O54908	8.47e-152	426	272	0.831	0.812	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
3	O57464	2.25e-82	249	259	0.538	0.552	O57464_XENLA Dickkopf WNT signaling pathway inhibitor 1 S homeolog precursor OS=Xenopus laevis OX=8355 GN=dkk1.S PE=2 SV=1
4	Q9PWH3	3.71e-71	220	240	0.459	0.508	Q9PWH3_DANRE Dickkopf WNT-signaling pathway inhibitor 1b OS=Danio rerio OX=7955 GN=DKK1 PE=2 SV=1
5	Q9W6D9	3.73e-69	215	241	0.451	0.498	Q9W6D9_DANRE Dickkopf-1 OS=Danio rerio OX=7955 GN=dkk1 PE=2 SV=1
6	Q9QYZ8	8.34e-57	184	259	0.425	0.436	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
7	Q9UBU2	1.70e-56	183	259	0.410	0.421	DKK2_HUMAN Dickkopf-related protein 2 OS=Homo sapiens OX=9606 GN=DKK2 PE=1 SV=1
8	A8WGT5	3.06e-51	170	255	0.462	0.482	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
9	A8KB56	8.32e-47	158	243	0.391	0.428	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
10	Q9UBT3	9.42e-37	131	224	0.289	0.344	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
11	Q8VEJ3	5.21e-30	114	221	0.244	0.294	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
12	Q9UBP4	7.90e-05	45.8	350	0.177	0.134	DKK3_HUMAN Dickkopf-related protein 3 OS=Homo sapiens OX=9606 GN=DKK3 PE=1 SV=2
13	Q9QUN9	1.36e-04	45.1	349	0.162	0.123	DKK3_MOUSE Dickkopf-related protein 3 OS=Mus musculus OX=10090 GN=Dkk3 PE=2 SV=1
14	C1K6H6	0.001	42.4	293	0.147	0.133	C1K6H6_DANRE Dickkopf long isoform OS=Danio rerio OX=7955 GN=dkk3 PE=2 SV=1
15	Q8R413	0.19	33.5	107	0.083	0.206	PROK2_RAT Prokineticin-2 OS=Rattus norvegicus OX=10116 GN=Prok2 PE=2 SV=1
16	Q8R414	0.24	33.1	105	0.079	0.200	PROK1_RAT Prokineticin-1 OS=Rattus norvegicus OX=10116 GN=Prok1 PE=3 SV=1
17	Q9HC23	0.39	33.1	129	0.068	0.140	PROK2_HUMAN Prokineticin-2 OS=Homo sapiens OX=9606 GN=PROK2 PE=1 SV=2
18	Q9VLT5	0.44	34.7	5322	0.086	0.004	POE_DROME Protein purity of essence OS=Drosophila melanogaster OX=7227 GN=poe PE=1 SV=1
19	P58294	0.65	32.0	105	0.079	0.200	PROK1_HUMAN Prokineticin-1 OS=Homo sapiens OX=9606 GN=PROK1 PE=1 SV=1
20	D3GDN2	0.95	31.6	107	0.075	0.187	D3GDN2_DANRE Prokineticin OS=Danio rerio OX=7955 GN=prok2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04706 Dickkopf_N	1.8e-15	68.3	Dickkopf N-terminal cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261349	0.999	Low-density lipoprotein receptor-related protein 6
2	9606.ENSP00000294304	0.999	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000331242	0.999	Kremen protein 1
4	9606.ENSP00000284523	0.988	Protein Wnt-3a
5	9606.ENSP00000304422	0.988	Kremen protein 2
6	9606.ENSP00000426653	0.980	Protein Wnt-8a
7	9606.ENSP00000293549	0.973	Proto-oncogene Wnt-1
8	9606.ENSP00000340677	0.967	Protein Wnt-8b
9	9606.ENSP00000287934	0.964	Frizzled-1
10	9606.ENSP00000348944	0.963	R-spondin-1
11	9606.ENSP00000363826	0.959	Frizzled-8
12	9606.ENSP00000323901	0.957	Frizzled-2
13	9606.ENSP00000367265	0.942	Cytoskeleton-associated protein 4
14	9606.ENSP00000377836	0.929	Glypican-3
15	9606.ENSP00000344456	0.925	Catenin beta-1
16	9606.ENSP00000220812	0.910	Dickkopf-related protein 4
17	9606.ENSP00000225512	0.909	Proto-oncogene Wnt-3
18	9606.ENSP00000285311	0.909	Dickkopf-related protein 2
19	9606.ENSP00000264634	0.903	Protein Wnt-5a
20	9606.ENSP00000325526	0.891	Protein Wnt-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0039706	0.735	co-receptor binding
GO:0005102	0.709	signaling receptor binding
GO:0140677	0.675	molecular function activator activity
GO:0048018	0.608	receptor ligand activity
GO:0048019	0.597	receptor antagonist activity
GO:0050750	0.579	low-density lipoprotein particle receptor binding
GO:0008083	0.548	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009968	0.990	negative regulation of signal transduction
GO:0030111	0.988	regulation of Wnt signaling pathway
GO:0009987	0.984	cellular process
GO:0030178	0.983	negative regulation of Wnt signaling pathway
GO:0048518	0.978	positive regulation of biological process
GO:0048856	0.976	anatomical structure development
GO:0048522	0.973	positive regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0031323	0.950	regulation of cellular metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0032501	0.945	multicellular organismal process
GO:0010604	0.938	positive regulation of macromolecule metabolic process
GO:0051093	0.909	negative regulation of developmental process
GO:0022603	0.904	regulation of anatomical structure morphogenesis
GO:0050896	0.899	response to stimulus
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0007275	0.889	multicellular organism development
GO:0010468	0.860	regulation of gene expression
GO:0043085	0.858	positive regulation of catalytic activity
GO:0051241	0.853	negative regulation of multicellular organismal process
GO:0060828	0.853	regulation of canonical Wnt signaling pathway
GO:2000027	0.850	regulation of animal organ morphogenesis
GO:0051716	0.847	cellular response to stimulus
GO:0043549	0.842	regulation of kinase activity
GO:0009889	0.837	regulation of biosynthetic process
GO:0051247	0.833	positive regulation of protein metabolic process
GO:0042327	0.822	positive regulation of phosphorylation
GO:0010941	0.815	regulation of cell death
GO:0001934	0.808	positive regulation of protein phosphorylation
GO:0051128	0.804	regulation of cellular component organization
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0019219	0.794	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.789	regulation of macromolecule biosynthetic process
GO:0007154	0.771	cell communication
GO:0023052	0.769	signaling
GO:1903506	0.765	regulation of nucleic acid-templated transcription
GO:0030278	0.762	regulation of ossification
GO:0006355	0.762	regulation of DNA-templated transcription
GO:0007165	0.758	signal transduction
GO:0090090	0.758	negative regulation of canonical Wnt signaling pathway
GO:0045596	0.751	negative regulation of cell differentiation
GO:1902531	0.732	regulation of intracellular signal transduction
GO:0090092	0.726	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0023056	0.712	positive regulation of signaling
GO:0009967	0.695	positive regulation of signal transduction
GO:0009892	0.688	negative regulation of metabolic process
GO:0010605	0.682	negative regulation of macromolecule metabolic process
GO:0009888	0.680	tissue development
GO:0051172	0.677	negative regulation of nitrogen compound metabolic process
GO:0031324	0.677	negative regulation of cellular metabolic process
GO:2000026	0.666	regulation of multicellular organismal development
GO:0048731	0.663	system development
GO:0048513	0.660	animal organ development
GO:0030279	0.653	negative regulation of ossification
GO:0006357	0.626	regulation of transcription by RNA polymerase II
GO:0044087	0.605	regulation of cellular component biogenesis
GO:0090101	0.572	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051129	0.527	negative regulation of cellular component organization
GO:0007166	0.496	cell surface receptor signaling pathway
GO:0009653	0.436	anatomical structure morphogenesis
GO:0031327	0.399	negative regulation of cellular biosynthetic process
GO:0048869	0.391	cellular developmental process
GO:0045934	0.388	negative regulation of nucleobase-containing compound metabolic process
GO:0030154	0.384	cell differentiation
GO:1902533	0.379	positive regulation of intracellular signal transduction
GO:0071840	0.361	cellular component organization or biogenesis
GO:0032879	0.347	regulation of localization
GO:0009891	0.346	positive regulation of biosynthetic process
GO:0010557	0.342	positive regulation of macromolecule biosynthetic process
GO:0010558	0.341	negative regulation of macromolecule biosynthetic process
GO:0051254	0.335	positive regulation of RNA metabolic process
GO:0042127	0.331	regulation of cell population proliferation
GO:0045859	0.327	regulation of protein kinase activity
GO:0044092	0.319	negative regulation of molecular function
GO:0016043	0.318	cellular component organization
GO:0007267	0.317	cell-cell signaling
GO:0031328	0.316	positive regulation of cellular biosynthetic process
GO:0051094	0.313	positive regulation of developmental process
GO:1902680	0.311	positive regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.987	intracellular anatomical structure
GO:0005615	0.987	extracellular space
GO:0005737	0.973	cytoplasm
GO:0043226	0.966	organelle
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0016020	0.914	membrane
GO:0071944	0.908	cell periphery
GO:0005886	0.849	plasma membrane
GO:0012505	0.808	endomembrane system
GO:0031982	0.786	vesicle
GO:0031410	0.598	cytoplasmic vesicle
GO:0070013	0.500	intracellular organelle lumen
GO:0098588	0.310	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]