StarFunc result for job id O94910

User Input

>input (1474 residues)
MARLAAVLWNLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVEN
ANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYK
YLEVQYDCVPYKVEQKVFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWI
PYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYDGAVFYNKERTRNIVKYDLRT
RIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTL
RFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSL
TFPNPYQFISSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT
PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFC
EPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQV
AQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG
KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAF
LLADNVREPARFLAAKENVVLEVTVLNTEGQVQELVFPQEEYPRKNSIQLSAKTIKQNSR
NGVVKVVFILYNNLGLFLSTENATVKLAGEAGPGGPGGASLVVNSQVIAASINKESSRVF
LMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTN
FAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLC
INLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEY
SRTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLV
FLMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLLFINKESVVMAY
LFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNTR
YYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPVLQPRGGTSPY
NTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFP
PGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAKGPPPPEPPVPPVPGGGGEE
EAGGPGGADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPG
RDSLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGY
YQVRRPSHEGYLAAPGLEGPGPDGDGQMQLVTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QM07	0.455	0.439	0.000	1540	0.555	0.531	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	AFDB:O88917	0.620	0.605	0.000	1515	0.976	0.949	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
3	AFDB:O88923	0.623	0.618	0.000	1487	0.644	0.638	O88923.pdb.gz	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
4	AFDB:O94910	0.999	0.999	0.000	1474	1.000	1.000	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
5	AFDB:O95490	0.555	0.560	0.000	1459	0.651	0.657	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
6	AFDB:Q9HAR2	0.395	0.400	0.000	1447	0.541	0.551	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
7	AFDB:Q9Z173	0.505	0.485	0.000	1550	0.541	0.514	Q9Z173.pdb.gz	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
8	AFDB:F6P980	0.227	0.263	2.878E-39	1241	0.166	0.197	F6P980.pdb.gz
9	PDB:5amoB	0.159	0.885	2.904E-22	257	0.066	0.381	5amoB.pdb.gz
10	PDB:7tynR	0.155	0.553	1.157E-9	373	0.043	0.169	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
11	PDB:7d3sR	0.156	0.757	1.517E-9	266	0.047	0.259	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
12	PDB:7lciR	0.148	0.504	3.752E-9	393	0.043	0.163	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
13	PDB:7durR	0.156	0.569	1.273E-8	371	0.052	0.205	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
14	PDB:7vqxR	0.148	0.554	1.748E-8	361	0.045	0.186	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
15	PDB:4k5yC	0.149	0.795	1.829E-8	248	0.042	0.250	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
16	PDB:6vn7R	0.152	0.756	2.511E-8	263	0.047	0.262	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
17	PDB:6wpwR	0.155	0.520	4.322E-8	398	0.043	0.161	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
18	PDB:7cz5R	0.154	0.752	4.522E-8	269	0.043	0.238	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
19	AFDB:A0A0R4IF44	0.125	0.105	4.222E-4	1792	0.066	0.055	A0A0R4IF44.pdb.gz
20	AFDB:X1WE68	0.076	0.049	6.947E-4	2527	0.111	0.065	X1WE68.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q6E9	0.0	1504	1492	0.541	0.534	A0A2R8Q6E9_DANRE Adhesion G protein-coupled receptor L3 isoform X5 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	A0A2R8QM07	0.0	1573	1540	0.557	0.533	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
3	F1Q579	0.0	1559	1534	0.554	0.533	F1Q579_DANRE Adhesion G protein-coupled receptor L3 isoform X3 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=3
4	O88917	0.0	2963	1515	0.981	0.954	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
5	O88923	0.0	1934	1487	0.648	0.642	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
6	O94910	0.0	3053	1474	1.000	1.000	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
7	O95490	0.0	1959	1459	0.652	0.659	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
8	Q80TR1	0.0	2976	1466	0.979	0.984	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
9	Q80TS3	0.0	1592	1537	0.547	0.525	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
10	Q8JZZ7	0.0	1927	1487	0.645	0.640	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
11	Q9HAR2	0.0	1569	1447	0.547	0.557	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
12	Q9Z173	0.0	1592	1550	0.554	0.527	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
13	Q9HBW9	9.89e-107	357	690	0.144	0.307	AGRL4_HUMAN Adhesion G protein-coupled receptor L4 OS=Homo sapiens OX=9606 GN=ADGRL4 PE=1 SV=3
14	Q9ESC1	3.12e-103	349	738	0.148	0.295	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1
15	G5EDW2	2.86e-80	289	1014	0.134	0.195	LPLT1_CAEEL Latrophilin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=lat-1 PE=1 SV=1
16	G5ECX0	4.60e-77	283	1338	0.106	0.117	LPLT2_CAEEL Latrophilin-like protein LAT-2 OS=Caenorhabditis elegans OX=6239 GN=lat-2 PE=2 SV=1
17	Q61549	2.39e-76	276	931	0.112	0.177	AGRE1_MOUSE Adhesion G protein-coupled receptor E1 OS=Mus musculus OX=10090 GN=Adgre1 PE=1 SV=1
18	Q5Y4N8	3.38e-76	275	932	0.113	0.178	AGRE1_RAT Adhesion G protein-coupled receptor E2 OS=Rattus norvegicus OX=10116 GN=Adgre1 PE=2 SV=1
19	P48960	4.88e-75	270	835	0.101	0.178	AGRE5_HUMAN Adhesion G protein-coupled receptor E5 OS=Homo sapiens OX=9606 GN=ADGRE5 PE=1 SV=4
20	A1Z7G7	1.34e-71	267	1697	0.141	0.123	LPHN_DROME Latrophilin Cirl OS=Drosophila melanogaster OX=7227 GN=Cirl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	9.5e-64	226.6	7 transmembrane receptor (Secretin family)
2	PF16489 GAIN	1.3e-51	186.5	GPCR-Autoproteolysis INducing (GAIN) domain
3	PF02140 Gal_Lectin	2.6e-19	80.7	Galactose binding lectin domain
4	PF01825 GPS	2.2e-10	52.3	GPCR proteolysis site, GPS, motif
5	PF02793 HRM	3.5e-05	35.3	Hormone receptor domain
6	PF02354 Latrophilin	1.7e-146	499.8	Latrophilin Cytoplasmic C-terminal region
7	PF02191 OLF	1.7e-83	291.5	Olfactomedin-like domain
8	PF06637 PV-1	7.9e+02	10.2	PV-1 protein (PLVAP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429430	0.999	Teneurin-2
2	9606.ENSP00000358565	0.922	CMP-sialic acid transporter
3	9606.ENSP00000278550	0.891	Teneurin-4
4	9606.ENSP00000403954	0.865	Teneurin-1
5	9606.ENSP00000265459	0.814	Neurexin-2
6	9606.ENSP00000359172	0.768	UDP-N-acetylglucosamine transporter
7	9606.ENSP00000424226	0.768	Teneurin-3
8	9606.ENSP00000246841	0.692	Leucine-rich repeat transmembrane protein FLRT1
9	9606.ENSP00000419975	0.667	PEX5-related protein
10	9606.ENSP00000225941	0.654	ABI gene family member 3
11	9606.ENSP00000367292	0.649	Leucine-rich repeat transmembrane protein FLRT3
12	9606.ENSP00000286574	0.644	Wnt inhibitory factor 1
13	9606.ENSP00000239462	0.633	Tenascin-N
14	9606.ENSP00000265131	0.633	Tenascin
15	9606.ENSP00000356646	0.633	Tenascin-R
16	9606.ENSP00000293441	0.610	SH3 and multiple ankyrin repeat domains protein 1
17	9606.ENSP00000364627	0.610	NXPE family member 4
18	9606.ENSP00000452762	0.588	Electron transfer flavoprotein subunit alpha, mitochondrial
19	9606.ENSP00000272641	0.585	Neurexophilin-2
20	9606.ENSP00000385142	0.579	Neurexin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0032501	0.966	multicellular organismal process
GO:0050896	0.961	response to stimulus
GO:0051716	0.878	cellular response to stimulus
GO:0007154	0.872	cell communication
GO:0048518	0.872	positive regulation of biological process
GO:0023052	0.845	signaling
GO:0048522	0.832	positive regulation of cellular process
GO:0050803	0.828	regulation of synapse structure or activity
GO:0007186	0.815	G protein-coupled receptor signaling pathway
GO:0050807	0.775	regulation of synapse organization
GO:0044087	0.770	regulation of cellular component biogenesis
GO:0032502	0.750	developmental process
GO:0051239	0.652	regulation of multicellular organismal process
GO:0048856	0.624	anatomical structure development
GO:0051130	0.587	positive regulation of cellular component organization
GO:0051240	0.576	positive regulation of multicellular organismal process
GO:0051094	0.543	positive regulation of developmental process
GO:0007275	0.442	multicellular organism development
GO:0007155	0.414	cell adhesion
GO:0051960	0.400	regulation of nervous system development
GO:0044089	0.369	positive regulation of cellular component biogenesis
GO:0048731	0.341	system development
GO:1901888	0.316	regulation of cell junction assembly
GO:0051962	0.305	positive regulation of nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005886	0.986	plasma membrane
GO:0045202	0.676	synapse
GO:0043227	0.600	membrane-bounded organelle
GO:0005622	0.599	intracellular anatomical structure
GO:0005737	0.545	cytoplasm
GO:0043005	0.525	neuron projection
GO:0098590	0.525	plasma membrane region
GO:0097060	0.489	synaptic membrane
GO:0030424	0.354	axon
GO:0098794	0.343	postsynapse
GO:0098978	0.338	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]