StarFunc result for job id O94911

User Input

>input (1621 residues)
MRKRKISVCQQTWALLCKNFLKKWRMKRESLMEWLNSLLLLLCLYIYPHSHQVNDFSSLL
TMDLGRVDTFNESRFSVVYTPVTNTTQQIMNKVASTPFLAGKEVLGLPDEESIKEFTANY
PEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVAL
QAAINAAIIEITTNHSVMEELMSVTGKNMKMHSFIGQSGVITDLYLFSCIISFSSFIYYA
SVNVTRERKRMKALMTMMGLRDSAFWLSWGLLYAGFIFIMALFLALVIRSTQFIILSGFM
VVFSLFLLYGLSLVALAFLMSILVKKSFLTGLVVFLLTVFWGCLGFTSLYRHLPASLEWI
LSLLSPFAFMLGMAQLLHLDYDLNSNAFPHPSDGSNLIVATNFMLAFDTCLYLALAIYFE
KILPNEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAI
RIRNVTKEYKGKPDKIEALKDLVFDIYEGQITAILGHSGAGKSTLLNILSGLSVPTKGSV
TIYNNKLSEMADLENLSKLTGVCPQSNVQFDFLTVRENLRLFAKIKGILPQEVDKEIQRV
LLELEMKNIQDVLAQNLSGGQKRKLTFGIAILGDPQIFLLDEPTAGLDPFSRHQVWNLLK
ERKTDRVILFSTQFMDEADILADRKVFLSQGKLKCAGSSLFLKKKWGIGYHLSLQLNEIC
VEENITSLVKQHIPDAKLSAKSEGKLIYTLPLERTNKFPELYKDLDSYPDLGIENYGVSM
TTLNEVFLKLEGKSTINESDIAILGEVQAEKADDTERLVEMEQVLSSLNKMRKTIGGVAL
WRQQICAIARVRLLKLKHERKALLALLLILMAGFCPLLVEYTMVKIYQNSYTWELSPHLY
FLAPGQQPHDPLTQLLIINKTGASIDDFIQSVEHQNIALEVDAFGTRNGTDDPSYNGAIT
VCCNEKNYSFSLACNAKRLNCFPVLMDIVSNGLLGMVKPSVHIRTERSTFLENGQDNPIG
FLAYIMFWLVLTSSCPPYIAMSSIDDYKNRARSQLRISGLSPSAYWFGQALVDVSLYFLV
FVFIYLMSYISNFEDMLLTIIHIIQIPCAVGYSFSLIFMTYVISFIFRKGRKNSGIWSFC
FYVVTVFSVAGFAFSIFESDIPFIFTFLIPPATMIGCLFLSSHLLFSSLFSEERMDVQPF
LVFLIPFLHFIIFLFTLRCLEWKFGKKSMRKDPFFRISPRSSDVCQNPEEPEGEDEDVQM
ERVRTANALNSTNFDEKPVIIASCLRKEYAGKRKGCFSKRKNKIATRNVSFCVRKGEVLG
LLGHNGAGKSTSIKVITGDTKPTAGQVLLKGSGGGDALEFLGYCPQENALWPNLTVRQHL
EVYAAVKGLRKGDAEVAITRLVDALKLQDQLKSPVKTLSEGIKRKLCFVLSILGNPSVVL
LDEPSTGMDPEGQQQMWQAIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLRCIG
SIQHLKSKFGKDYLLEMKVKNLAQVEPLHAEILRLFPQAARQERYSSLMVYKLPVEDVQP
LAQAFFKLEKVKQSFDLEEYSLSQSTLEQVFLELSKEQELGDFEEDFDPSVKWKLLPQEE
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94911	1.000	1.000	0.000	1621	1.000	1.000	O94911.pdb.gz	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	AFDB:Q8CF82	0.918	0.907	0.000	1642	0.414	0.409	Q8CF82.pdb.gz	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	AFDB:Q8K440	0.979	0.980	0.000	1620	0.754	0.754	Q8K440.pdb.gz	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	AFDB:Q8K449	0.984	0.983	0.000	1623	0.663	0.662	Q8K449.pdb.gz	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
5	AFDB:Q8N139	0.937	0.939	0.000	1617	0.590	0.592	Q8N139.pdb.gz	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
6	AFDB:Q99758	0.760	0.727	6.267E-93	1704	0.258	0.246	Q99758.pdb.gz	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
7	AFDB:E9PWH4	0.768	0.748	9.718E-93	1668	0.253	0.246	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
8	AFDB:A0A0G2K1Q8	0.766	0.733	1.719E-92	1704	0.271	0.258	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
9	AFDB:E9PX95	0.765	0.721	3.466E-90	1733	0.246	0.230	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
10	AFDB:Q555Z5	0.712	0.715	6.131E-90	1615	0.250	0.251	Q555Z5.pdb.gz	ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcA4 PE=3 SV=1
11	PDB:7w01A	0.768	0.778	3.107E-80	1598	0.254	0.258	7w01A.pdb.gz
12	PDB:7w02A	0.691	0.712	1.960E-77	1566	0.250	0.259	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
13	PDB:7lkzA	0.677	0.584	2.606E-70	1920	0.240	0.203	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.678	0.581	1.644E-67	1928	0.239	0.201	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7qA	0.638	0.539	4.607E-64	1958	0.239	0.198	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
16	PDB:7e7iA	0.658	0.543	6.836E-64	2011	0.234	0.188	7e7iA.pdb.gz
17	PDB:7tbyA	0.652	0.597	1.794E-63	1788	0.225	0.204	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
18	PDB:7roqA	0.608	0.543	7.460E-56	1831	0.201	0.178	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
19	PDB:7m1pA	0.627	0.534	5.137E-53	1938	0.212	0.178	7m1pA.pdb.gz
20	PDB:7m1qA	0.588	0.508	3.101E-44	1911	0.210	0.178	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94911	0.0	3354	1621	1.000	1.000	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	Q8CF82	0.0	1233	1642	0.419	0.414	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	Q8K440	0.0	2440	1620	0.754	0.755	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	Q8K448	0.0	1236	1642	0.420	0.415	ABCA5_MOUSE Cholesterol transporter ABCA5 OS=Mus musculus OX=10090 GN=Abca5 PE=1 SV=2
5	Q8K449	0.0	2123	1623	0.665	0.664	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
6	Q8N139	0.0	1850	1617	0.597	0.598	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
7	Q8WWZ7	0.0	1256	1642	0.423	0.417	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
8	Q6XBG2	2.93e-157	524	1668	0.263	0.255	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	E9PWH4	3.87e-157	524	1668	0.263	0.255	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	Q385F7	1.58e-136	467	1738	0.250	0.233	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
11	Q54BT5	2.18e-135	463	1702	0.249	0.237	ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcA3 PE=3 SV=1
12	Q8T6J1	7.68e-122	423	1631	0.246	0.245	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
13	A0A0G2K1Q8	7.69e-97	348	1704	0.143	0.136	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
14	Q8R420	3.53e-96	346	1704	0.144	0.137	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
15	Q99758	8.64e-92	332	1704	0.134	0.128	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
16	P34358	6.96e-88	320	1704	0.190	0.181	CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=6
17	C0P274	7.56e-88	320	1758	0.231	0.213	C0P274_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=1
18	Q9ESR9	2.60e-86	316	2434	0.160	0.107	ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus OX=10116 GN=Abca2 PE=1 SV=1
19	K9J4V5	6.87e-85	311	2262	0.159	0.114	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1
20	A0A087WXK5	3.39e-82	303	2466	0.156	0.103	A0A087WXK5_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	4.3e+02	11.8	AAA ATPase domain
2	PF13191 AAA_16	11	17.9	AAA ATPase domain
3	PF13304 AAA_21	6.3e-14	64.1	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	5.9e+02	12.1	AAA domain
5	PF13476 AAA_23	58	15.6	AAA domain
6	PF13481 AAA_25	1.1e+02	13.8	AAA domain
7	PF13555 AAA_29	0.013	26.5	P-loop containing region of AAA domain
8	PF13604 AAA_30	1.9e+02	13.2	AAA domain
9	PF12698 ABC2_membrane_3	1.4e-34	131.4	ABC-2 family transporter protein
10	PF00005 ABC_tran	4.6e-57	203.8	ABC transporter
11	PF00006 ATP-synt_ab	4e+02	12.1	ATP synthase alpha/beta family, nucleotide-binding domain
12	PF13732 DUF4162	31	16.7	Domain of unknown function (DUF4162)
13	PF00350 Dynamin_N	4.4e+02	12.3	Dynamin family
14	PF01926 MMR_HSR1	3.2	19.3	50S ribosome-binding GTPase
15	PF03215 Rad17	3.6e+02	12.5	Rad17 P-loop domain
16	PF03193 RsgA_GTPase	7.6e-05	34.2	RsgA GTPase
17	PF13558 SbcC_Walker_B	1.6e+02	13.9	SbcC/RAD50-like, Walker B motif
18	PF02463 SMC_N	0.44	21.5	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337335	0.786	Solute carrier family 22 member 8
2	9606.ENSP00000269503	0.679	Cerebellin-2
3	9606.ENSP00000371483	0.656	Sodium-dependent phosphate transport protein 2B
4	9606.ENSP00000261200	0.602	ATP-binding cassette sub-family C member 9
5	9606.ENSP00000284425	0.550	ATP-binding cassette sub-family A member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008559	0.995	ABC-type xenobiotic transporter activity
GO:0005488	0.978	binding
GO:0005515	0.907	protein binding
GO:0017111	0.778	ribonucleoside triphosphate phosphatase activity
GO:0005319	0.772	lipid transporter activity
GO:0035639	0.692	purine ribonucleoside triphosphate binding
GO:0032555	0.681	purine ribonucleotide binding
GO:0016887	0.645	ATP hydrolysis activity
GO:0005524	0.635	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0065007	0.994	biological regulation
GO:0071702	0.992	organic substance transport
GO:0009987	0.990	cellular process
GO:0008152	0.990	metabolic process
GO:1905952	0.980	regulation of lipid localization
GO:0071704	0.978	organic substance metabolic process
GO:0010876	0.975	lipid localization
GO:0015850	0.973	organic hydroxy compound transport
GO:0010874	0.970	regulation of cholesterol efflux
GO:0006869	0.969	lipid transport
GO:0044237	0.945	cellular metabolic process
GO:0006807	0.931	nitrogen compound metabolic process
GO:0044238	0.922	primary metabolic process
GO:0015918	0.918	sterol transport
GO:1901564	0.915	organonitrogen compound metabolic process
GO:0051050	0.861	positive regulation of transport
GO:0030301	0.857	cholesterol transport
GO:0032376	0.811	positive regulation of cholesterol transport
GO:0006629	0.735	lipid metabolic process
GO:0055085	0.528	transmembrane transport
GO:0009058	0.409	biosynthetic process
GO:0006793	0.353	phosphorus metabolic process
GO:0050794	0.343	regulation of cellular process
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031974	0.818	membrane-enclosed lumen
GO:0070013	0.755	intracellular organelle lumen
GO:0005634	0.700	nucleus
GO:0031981	0.485	nuclear lumen
GO:0005654	0.440	nucleoplasm
GO:0031090	0.388	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.2	0.995	ABC-type xenobiotic transporter.
RHEA:23680	0.778	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.778	nucleoside-triphosphate phosphatase.
RHEA:13065	0.645	ATP + H2O = ADP + H(+) + phosphate

[back to server]