StarFunc result for job id O94913

User Input

>input (1555 residues)
MSEQTPAEAGAAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEA
QTAKAPSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVATFICVFEKVDENTRKSLFKLRS
TWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKSPEEPSTPGTVV
SSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQLAVSLSV
QQETSNLGPGSAPSKLHVSQIPPMAVKAPHQVPVQSEKSRPGPSLQIQDLKGTNRDPRLN
RISQHSHGKDQSHRKEFLMNTLNQSDTKTSKTIPSEKLNSSKQEKSKSGEKITKKELDQL
DSKSKSKSKSPSPLKNKLSHTKDLKNQESESMRLSDMNKRDPRLKKHLQDKTDGKDDDVK
EKRKTAEKKDKDEHMKSSEHRLAGSRNKIINGIVQKQDTITEESEKQGTKPGRSSTRKRS
RSRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPTSTPKAGKIRQSGAKQSHMEEFTPPSRE
DRNAKRSTKQDIRDPRRMKKTEEERPQETTNQHSTKSGTEPKENVENWQSSKSAKRWKSG
WEENKSLQQVDEHSKPPHLRHRESWSSTKGILSPRAPKQQQHRLSVDANLQIPKELTLAS
KRELLQKTSERLASGEITQDDFLVVVHQIRQLFQYQEGVREEQRSPFNDRFPLKRPRYED
SDKPFVDSPASRFAGLDTNQRLTALAEDRPLFDGPSRPSVARDGPTKMIFEGPNKLSPRI
DGPPTPASLRFDGSPGQMGGGGPLRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQ
AGGGGFRFEGSPGLRFEGSPGGLRFEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVG
GLRFDNPRGQPVGGLRFEGGHGPSGAAIRFDGPHGQPGGGIRFEGPLLQQGVGMRFEGPH
GQSVAGLRFEGQHNQLGGNLRFEGPHGQPGVGIRFEGPLVQQGGGMRFEGPSVPGGGLRI
EGPLGQGGPRFEGCHALRFDGQPGQPSLLPRFDGLHGQPGPRFERTPGQPGPQRFDGPPG
QQVQPRFDGVPQRFDGPQHQQASRFDIPLGLQGTRFDNHPSQRLESVSFNQTGPYNDPPG
NAFNAPSQGLQFQRHEQIFDSPQGPNFNGPHGPGNQSFSNPLNRASGHYFDEKNLQSSQF
GNFGNIPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYP
DNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTN
FTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVT
HRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAV
ESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVE
NPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94913	1.000	1.000	0.000	1555	1.000	1.000	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
2	AFDB:F1QGD0	0.147	0.154	1.304E-78	1457	0.444	0.474	F1QGD0.pdb.gz
3	AFDB:A1Z9W4	0.093	0.075	2.979E-30	1953	0.221	0.176	A1Z9W4.pdb.gz	A1Z9W4_DROME LD11480p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=2
4	AFDB:Q54S20	0.034	0.023	1.846E-7	2678	0.134	0.078	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
5	AFDB:O95104	0.079	0.107	2.569E-7	1147	0.134	0.181	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
6	AFDB:Q63627	0.081	0.104	4.216E-7	1200	0.142	0.184	Q63627.pdb.gz	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
7	AFDB:Q5VT52	0.085	0.090	1.354E-5	1461	0.152	0.162	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
8	AFDB:Q9UPN6	0.083	0.101	1.783E-5	1271	0.134	0.164	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
9	AFDB:Q9UMD9	0.032	0.032	1.904E-4	1497	0.150	0.156	Q9UMD9.pdb.gz	COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens OX=9606 GN=COL17A1 PE=1 SV=3
10	AFDB:M9NGY4	0.039	0.034	2.958E-4	1885	0.147	0.121	M9NGY4.pdb.gz	M9NGY4_DROME ZAP3, isoform E OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=1
11	PDB:7oo3c	0.073	0.659	1.124E-1	141	0.013	0.142	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:4hm9A	0.060	0.157	1.255E-1	511	0.012	0.035	4hm9A.pdb.gz
13	PDB:5ok9B	0.053	0.213	1.747E-1	242	0.014	0.087	5ok9B.pdb.gz
14	PDB:7bfpC	0.043	0.141	2.568E-1	298	0.011	0.057	7bfpC.pdb.gz
15	PDB:7mqzA	0.059	0.210	2.714E-1	209	0.010	0.072	7mqzA.pdb.gz
16	PDB:7d5sRN	0.048	0.102	3.030E-1	607	0.023	0.059	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:6zqaUB	0.048	0.117	4.454E-1	504	0.024	0.073	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
18	PDB:6rrdO	0.050	0.117	4.973E-1	504	0.015	0.046	6rrdO.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
19	PDB:3tj1A	0.054	0.137	5.552E-1	483	0.013	0.041	3tj1A.pdb.gz
20	PDB:5wlcST	0.034	0.080	5.552E-1	599	0.017	0.045	5wlcST.pdb.gz	The complete structure of the small-subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94913	0.0	3176	1555	1.000	1.000	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
2	Q5U393	0.0	929	1457	0.451	0.482	Q5U393_DANRE Cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:175013 PE=1 SV=1
3	E1JH68	4.56e-41	163	573	0.060	0.164	E1JH68_DROME FI20283p1 OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=1
4	Q8IGR2	4.56e-41	163	573	0.060	0.164	Q8IGR2_DROME RE43027p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=2 SV=1
5	A0A0B4LFF9	2.52e-40	166	1839	0.060	0.051	A0A0B4LFF9_DROME Pcf11 cleavage and polyadenylation factor subunit, isoform E OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=1
6	A0A0B4LF47	2.77e-40	166	1850	0.060	0.051	A0A0B4LF47_DROME Pcf11 cleavage and polyadenylation factor subunit, isoform F OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=1
7	A0A0B4LFE6	2.82e-40	166	1945	0.060	0.048	A0A0B4LFE6_DROME Pcf11 cleavage and polyadenylation factor subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=1
8	A1Z9W4	2.85e-40	166	1953	0.060	0.048	A1Z9W4_DROME LD11480p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=2
9	Q10237	9.58e-20	97.8	638	0.032	0.077	YD14_SCHPO Uncharacterized protein C4G9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.04c PE=4 SV=1
10	Q0WPF2	9.21e-19	95.1	808	0.035	0.067	PCFS4_ARATH Polyadenylation and cleavage factor homolog 4 OS=Arabidopsis thaliana OX=3702 GN=PCFS4 PE=1 SV=1
11	P39081	2.74e-15	83.6	626	0.028	0.070	PCF11_YEAST Protein PCF11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCF11 PE=1 SV=2
12	Q9FIX8	8.73e-12	71.2	410	0.030	0.115	PCFS5_ARATH Polyadenylation and cleavage factor homolog 5 OS=Arabidopsis thaliana OX=3702 GN=PCFS5 PE=1 SV=1
13	C0P8M6	3.63e-07	51.6	86	0.017	0.314	C0P8M6_DROME MIP05908p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=2 SV=1
14	Q960D3	0.002	44.7	412	0.024	0.092	Q960D3_DROME SD06613p OS=Drosophila melanogaster OX=7227 GN=vig2 PE=1 SV=1
15	Q9VBX3	0.003	44.3	443	0.024	0.086	Q9VBX3_DROME Vig2, isoform B OS=Drosophila melanogaster OX=7227 GN=vig2 PE=1 SV=2
16	Q9NQG5	0.004	43.5	326	0.019	0.089	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
17	Q96P16	0.013	42.0	312	0.017	0.083	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
18	Q63623	0.022	42.0	1268	0.026	0.032	SCAF8_RAT SR-related and CTD-associated factor 8 OS=Rattus norvegicus OX=10116 GN=Scaf8 PE=1 SV=1
19	O96124	0.030	41.6	2441	0.026	0.017	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
20	A8DYK5	0.30	38.1	1306	0.017	0.020	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11526 CFIA_Pcf11	36	16.2	Subunit of cleavage factor IA Pcf11
2	PF04818 CID	1.8e-10	52.6	CID domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298281

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000434995	0.998	Polyribonucleotide 5'-hydroxyl-kinase Clp1
2	9606.ENSP00000315791	0.997	Cleavage stimulation factor subunit 3
3	9606.ENSP00000298875	0.990	Cleavage and polyadenylation specificity factor subunit 2
4	9606.ENSP00000362063	0.988	Cleavage stimulation factor subunit 2
5	9606.ENSP00000336752	0.987	Pre-mRNA 3'-end-processing factor FIP1
6	9606.ENSP00000238112	0.978	Cleavage and polyadenylation specificity factor subunit 3
7	9606.ENSP00000291386	0.972	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
8	9606.ENSP00000332444	0.968	Cleavage stimulation factor subunit 2 tau variant
9	9606.ENSP00000300291	0.966	Cleavage and polyadenylation specificity factor subunit 5
10	9606.ENSP00000484669	0.965	Cleavage and polyadenylation specificity factor subunit 1
11	9606.ENSP00000421592	0.962	THO complex subunit 4
12	9606.ENSP00000245934	0.961	Symplekin
13	9606.ENSP00000317872	0.961	E3 ubiquitin-protein ligase RBBP6
14	9606.ENSP00000325377	0.957	pre-mRNA 3' end processing protein WDR33
15	9606.ENSP00000292476	0.952	Cleavage and polyadenylation specificity factor subunit 4
16	9606.ENSP00000266679	0.946	Cleavage and polyadenylation specificity factor subunit 6
17	9606.ENSP00000413098	0.946	Protein SCAF8
18	9606.ENSP00000480158	0.946	DNA-directed RNA polymerase II subunit RPB1
19	9606.ENSP00000216277	0.915	Poly(A) polymerase alpha
20	9606.ENSP00000217109	0.915	Cleavage stimulation factor subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0019899	0.550	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0080090	0.983	regulation of primary metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0010556	0.957	regulation of macromolecule biosynthetic process
GO:0031326	0.957	regulation of cellular biosynthetic process
GO:0051252	0.957	regulation of RNA metabolic process
GO:2001141	0.919	regulation of RNA biosynthetic process
GO:0051128	0.915	regulation of cellular component organization
GO:0071704	0.625	organic substance metabolic process
GO:0043170	0.570	macromolecule metabolic process
GO:0009987	0.428	cellular process
GO:0044238	0.387	primary metabolic process
GO:0044237	0.384	cellular metabolic process
GO:0006807	0.379	nitrogen compound metabolic process
GO:0010468	0.377	regulation of gene expression
GO:0043244	0.367	regulation of protein-containing complex disassembly
GO:0010467	0.348	gene expression
GO:0090304	0.345	nucleic acid metabolic process
GO:0016070	0.343	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005739	0.999	mitochondrion
GO:0032991	0.585	protein-containing complex
GO:0016604	0.432	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]