StarFunc result for job id O94915

User Input

>input (1400 residues)
MSNITIDPDVKPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLSRSLQRGEDLQFDQLI
SSMSSVAEHCLPSLLRTLFDWYRRQNGTEDESYEYRPRSSTKSKGDEQQRERDYLLERRD
LAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEGYSGTNTGNVHIIADLY
AEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFE
ASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTT
FELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLY
RLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLD
FAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSLQQKDGEPPMPTTGVILPSG
NTLRVKKIFLNKTLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNK
EPEDMITGERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTL
QALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNQD
TQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL
EIPKGDDELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPISHQF
DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQLLSPQV
DINSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDS
GYSIDSKIIGIPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIK
EALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHFLNNTLLEYVD
LTRQLLEAENEKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHW
AGPFSIMFTPLDRYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNI
LDSLDKKVHQLGCEAVTLLLELNPDQSNLMYWAVDRCYTGSGRVAAGCFKAIANVFQNRD
YQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMFRYAHKLEVQRTDGVLSQLSPL
PHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVD
LKPLPTARRHDEDEDDSLKDRELMVTSRRWLRGEGWGSPQATAMVLNNLMYMTAKYGDEL
AWSEVENVWTTLADGWPKNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HDV6	0.417	0.295	4.649E-34	2196	0.205	0.131	Q9HDV6.pdb.gz	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
2	AFDB:P40468	0.557	0.355	1.509E-31	2376	0.211	0.125	P40468.pdb.gz	TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAO3 PE=1 SV=1
3	PDB:7pgsN	0.395	0.334	8.743E-14	1787	0.132	0.104	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
4	PDB:7mp6B	0.390	0.355	2.152E-11	1609	0.129	0.112	7mp6B.pdb.gz
5	PDB:7r04B	0.383	0.272	3.877E-11	2229	0.122	0.077	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
6	PDB:7mp5A	0.346	0.310	4.453E-11	1629	0.123	0.106	7mp5A.pdb.gz
7	PDB:7pgrN	0.368	0.247	5.675E-11	2423	0.129	0.074	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
8	PDB:7r04A	0.352	0.247	8.598E-11	2326	0.130	0.078	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
9	AFDB:Q54F23	0.230	0.205	2.337E-10	1647	0.103	0.087	Q54F23.pdb.gz	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
10	PDB:7r03B	0.309	0.217	1.005E-9	2246	0.115	0.072	7r03B.pdb.gz
11	AFDB:Q9W350	0.307	0.259	3.138E-9	1742	0.116	0.094	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
12	AFDB:Q93VS8	0.221	0.264	1.343E-8	1116	0.106	0.133	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
13	AFDB:Q7M6Y6	0.229	0.208	7.589E-8	1581	0.122	0.108	Q7M6Y6.pdb.gz	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
14	AFDB:F4I893	0.119	0.073	8.133E-8	2696	0.133	0.069	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
15	AFDB:P33892	0.152	0.089	8.420E-8	2672	0.120	0.063	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
16	AFDB:A0A1D8PKU7	0.162	0.135	8.716E-8	1859	0.134	0.101	A0A1D8PKU7.pdb.gz	A0A1D8PKU7_CANAL Ecm29p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ECM29 PE=4 SV=1
17	AFDB:P35169	0.233	0.146	8.716E-8	2470	0.131	0.074	P35169.pdb.gz	TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR1 PE=1 SV=3
18	PDB:7mqaLM	0.154	0.115	6.991E-7	2041	0.131	0.090	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6x9oA	0.196	0.129	7.756E-7	2425	0.119	0.069	6x9oA.pdb.gz
20	PDB:3w3uA	0.179	0.221	8.029E-7	1030	0.090	0.122	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JMD7	0.0	2524	3142	0.880	0.392	B8JMD7_DANRE Furry homolog,-like OS=Danio rerio OX=7955 GN=fc84g03 PE=1 SV=1
2	E9Q8I9	0.0	1967	3020	0.698	0.324	FRY_MOUSE Protein furry homolog OS=Mus musculus OX=10090 GN=Fry PE=1 SV=1
3	O94915	0.0	2924	3013	1.000	0.465	FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2
4	Q5DX48	0.0	622	2886	0.226	0.109	Q5DX48_CAEEL MOR2-PAG1_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-2 PE=1 SV=1
5	Q9VT28	0.0	881	3479	0.301	0.121	FRY_DROME Protein furry OS=Drosophila melanogaster OX=7227 GN=fry PE=1 SV=2
6	P40468	5.60e-45	181	2376	0.216	0.128	TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAO3 PE=1 SV=1
7	A0A1D8PJ86	1.73e-30	134	2830	0.113	0.056	A0A1D8PJ86_CANAL Cas4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAS4 PE=4 SV=1
8	Q9HDV6	8.33e-30	132	2196	0.082	0.052	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
9	A0A0B4KHX4	0.007	43.5	2734	0.032	0.016	A0A0B4KHX4_DROME Neurofibromin 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
10	A0A0B4KI28	0.007	43.5	2793	0.032	0.016	A0A0B4KI28_DROME Neurofibromin 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
11	Q8IMS2	0.007	43.5	2746	0.032	0.016	Q8IMS2_DROME Neurofibromin 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=2
12	Q59DT9	0.008	43.5	2764	0.032	0.016	Q59DT9_DROME Neurofibromin 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
13	Q9VBJ2	0.008	43.5	2802	0.032	0.016	Q9VBJ2_DROME Neurofibromin 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=3
14	O01397	0.010	43.1	2802	0.032	0.016	O01397_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
15	O01399	0.010	43.1	2764	0.032	0.016	O01399_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
16	O01398	0.011	43.1	2802	0.032	0.016	O01398_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
17	Q8VI95	1.8	35.0	361	0.021	0.083	OAS1D_MOUSE Inactive 2'-5'-oligoadenylate synthase 1D OS=Mus musculus OX=10090 GN=Oas1d PE=1 SV=1
18	Q8VZZ4	7.6	33.5	1466	0.014	0.014	AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana OX=3702 GN=ABCC6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14228 MOR2-PAG1_mid	9.7e-14	61.7	Cell morphogenesis central region
2	PF14222 MOR2-PAG1_N	1.1e-164	561.2	Cell morphogenesis N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351113

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229812	0.842	Serine/threonine-protein kinase 38
2	9606.ENSP00000373684	0.826	Serine/threonine-protein kinase 38-like
3	9606.ENSP00000251993	0.739	Uncharacterized protein KIAA0930
4	9606.ENSP00000251472	0.728	Microtubule-associated serine/threonine-protein kinase 1
5	9606.ENSP00000347730	0.725	Zinc finger protein 536
6	9606.ENSP00000301037	0.706	Uncharacterized serine/threonine-protein kinase SgK494
7	9606.ENSP00000313391	0.656	Disabled homolog 2
8	9606.ENSP00000317257	0.649	Copine-1
9	9606.ENSP00000439937	0.644	Homer protein homolog 3
10	9606.ENSP00000389900	0.641	DCN1-like protein 4
11	9606.ENSP00000406012	0.609	Intraflagellar transport protein 140 homolog
12	9606.ENSP00000273861	0.607	Sodium/bile acid cotransporter 4
13	9606.ENSP00000439182	0.607	Unconventional myosin-Ih
14	9606.ENSP00000370196	0.606	Myotubularin-related protein 5
15	9606.ENSP00000416951	0.569	Zinc finger CCCH-type containing 18
16	9606.ENSP00000262982	0.555	Exportin-2
17	9606.ENSP00000258418	0.552	Calcium-binding protein 39
18	9606.ENSP00000360165	0.551	Negatively regulates the Hedgehog (SHH) signaling. Binds to the promoter of the SHH signaling mediator, GLI1, and inhibits its expression
19	9606.ENSP00000479669	0.550	Calcium-binding protein 39-like
20	9606.ENSP00000356515	0.545	Utrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.815	regulation of biological process
GO:0048856	0.648	anatomical structure development
GO:0032501	0.417	multicellular organismal process
GO:0007275	0.383	multicellular organism development
GO:0050794	0.347	regulation of cellular process
GO:0009987	0.330	cellular process
GO:0019222	0.319	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0120025	0.974	plasma membrane bounded cell projection
GO:0071944	0.922	cell periphery
GO:0043226	0.835	organelle
GO:0005938	0.818	cell cortex
GO:0043229	0.665	intracellular organelle
GO:0036477	0.602	somatodendritic compartment
GO:0043005	0.594	neuron projection
GO:0030424	0.556	axon
GO:0030425	0.545	dendrite
GO:0043227	0.447	membrane-bounded organelle
GO:0045202	0.423	synapse
GO:0043231	0.421	intracellular membrane-bounded organelle
GO:0043228	0.354	non-membrane-bounded organelle
GO:0043232	0.341	intracellular non-membrane-bounded organelle
GO:0044297	0.337	cell body
GO:0016020	0.314	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]