StarFunc result for job id O94916

User Input

>input (1531 residues)
MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPP
PAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVS
EKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSP
SNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQL
TTDNKGNSKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEG
SRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEV
DIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIM
RKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQE
NVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFT
YTPDPAAAGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSS
MIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENE
KQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSRE
ILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQA
GSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSG
VSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEM
QQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPA
VSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQ
VNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIAD
AQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNI
FLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQ
AQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQ
QQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQ
EQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPAS
MSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSS
QQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSP
LASSINTNQNIEKIDLLVSLQNQGNNLTGSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZGB1	0.378	0.375	0.000	1548	0.913	0.903	D3ZGB1.pdb.gz	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
2	AFDB:F1QXN5	0.231	0.246	7.238E-83	1416	0.396	0.428	F1QXN5.pdb.gz
3	AFDB:O95153	0.057	0.050	1.107E-9	1857	0.100	0.082	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
4	AFDB:P14738	0.065	0.090	1.267E-8	1018	0.078	0.117	P14738.pdb.gz	FNBA_STAA8 Fibronectin-binding protein A OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fnbA PE=1 SV=1
5	AFDB:Q9JIR0	0.071	0.062	1.497E-8	1847	0.108	0.090	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
6	AFDB:P39060	0.044	0.041	1.229E-7	1754	0.135	0.118	P39060.pdb.gz	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5
7	AFDB:Q9VGW1	0.061	0.051	1.622E-7	1943	0.104	0.082	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
8	AFDB:Q0E9F2	0.061	0.061	1.714E-7	1542	0.072	0.071	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
9	AFDB:P39061	0.039	0.036	2.261E-7	1774	0.133	0.114	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
10	AFDB:Q90WE3	0.048	0.043	4.397E-7	1905	0.121	0.098	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
11	PDB:7tvzE	0.072	0.121	1.899E-5	665	0.019	0.044	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
12	PDB:1l9mB	0.078	0.143	5.148E-5	681	0.023	0.051	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
13	PDB:5mhlA	0.062	0.111	2.057E-4	692	0.021	0.046	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
14	PDB:3c2aL	0.064	0.261	2.175E-4	216	0.020	0.139	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
15	PDB:5ghuA	0.056	0.238	2.869E-4	201	0.016	0.124	5ghuA.pdb.gz
16	PDB:2qhrL	0.080	0.274	3.032E-4	218	0.017	0.119	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	PDB:6rrmA	0.061	0.162	3.205E-4	351	0.021	0.091	6rrmA.pdb.gz	Targeting the Mycobacterium tuberculosis transpeptidase LdtMt2with cysteine-reactive inhibitors including ebselen.
18	PDB:6enyC	0.088	0.263	4.993E-4	364	0.018	0.074	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
19	PDB:1knoE	0.075	0.289	5.896E-4	214	0.016	0.117	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
20	PDB:4pygA	0.078	0.133	5.896E-4	685	0.022	0.050	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZGB1	0.0	2588	1548	0.907	0.897	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
2	O94916	0.0	3073	1531	1.000	1.000	NFAT5_HUMAN Nuclear factor of activated T-cells 5 OS=Homo sapiens OX=9606 GN=NFAT5 PE=1 SV=1
3	Q6PD88	0.0	843	1415	0.432	0.468	Q6PD88_DANRE Nuclear factor of activated T-cells 5 OS=Danio rerio OX=7955 GN=nfat5 PE=1 SV=1
4	Q9WV30	0.0	2639	1534	0.923	0.921	NFAT5_MOUSE Nuclear factor of activated T-cells 5 OS=Mus musculus OX=10090 GN=Nfat5 PE=1 SV=2
5	M9PH25	6.45e-86	295	562	0.096	0.262	M9PH25_DROME NFAT nuclear factor, isoform G OS=Drosophila melanogaster OX=7227 GN=NFAT PE=4 SV=2
6	E1JJP6	9.06e-85	292	600	0.096	0.245	E1JJP6_DROME FI16827p1 OS=Drosophila melanogaster OX=7227 GN=NFAT PE=2 SV=1
7	A0A1D5PI24	2.13e-63	233	732	0.082	0.172	A0A1D5PI24_CHICK Nuclear factor of activated T cells 1 OS=Gallus gallus OX=9031 GN=NFATC1 PE=4 SV=2
8	O88942	1.14e-62	231	717	0.082	0.176	NFAC1_MOUSE Nuclear factor of activated T-cells, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Nfatc1 PE=1 SV=1
9	A0A8I6AB55	4.54e-62	234	1052	0.080	0.117	A0A8I6AB55_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
10	B5B2S1	6.34e-62	234	1075	0.081	0.115	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
11	Q12968	6.34e-62	234	1075	0.081	0.115	NFAC3_HUMAN Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
12	I3L3K7	6.41e-62	234	1047	0.081	0.118	I3L3K7_HUMAN Nuclear factor of activated T cells 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
13	A0A0G2JTY4	6.67e-62	234	1076	0.080	0.114	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
14	D3ZU59	7.28e-62	234	1068	0.080	0.115	D3ZU59_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
15	B5B2S0	7.41e-62	234	1068	0.081	0.116	B5B2S0_HUMAN Nuclear factor of activated T-cells c3 isoform IB-Xa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
16	A0A0G2JXL2	8.33e-62	232	925	0.082	0.136	A0A0G2JXL2_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=2
17	H3BRS1	9.63e-62	233	1060	0.081	0.117	H3BRS1_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
18	H3BR83	9.91e-62	233	1053	0.081	0.118	H3BR83_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
19	D3ZE20	1.31e-61	231	939	0.082	0.134	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
20	P97305	2.71e-61	232	1075	0.080	0.114	NFAC3_MOUSE Nuclear factor of activated T-cells, cytoplasmic 3 OS=Mus musculus OX=10090 GN=Nfatc3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16179 RHD_dimer	9.2e-24	94.8	Rel homology dimerisation domain
2	PF00554 RHD_DNA_bind	1.7e-16	72.1	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000023997

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000011309	0.781	Forkhead box protein P3
2	9544.ENSMMUP00000040085	0.772	Belongs to the bZIP family.
3	9544.ENSMMUP00000025243	0.762	GATA binding protein 4
4	9544.ENSMMUP00000013862	0.758	Macaca mulatta FBJ murine osteosarcoma viral oncogene homolog (FOS), mRNA
5	9544.ENSMMUP00000027764	0.667	Interleukin-2
6	9544.ENSMMUP00000013553	0.666	Cell death-inducing DFFA-like effector c
7	9544.ENSMMUP00000029753	0.633	Cyclic AMP-responsive element-binding protein 1 isoform A
8	9544.ENSMMUP00000025988	0.611	Karyopherin (importin) beta 1
9	9544.ENSMMUP00000004996	0.599	Macaca mulatta vascular endothelial growth factor C (VEGFC), mRNA
10	9544.ENSMMUP00000007511	0.596	JunB proto-oncogene, AP-1 transcription factor subunit
11	9544.ENSMMUP00000031743	0.596	JunD proto-oncogene, AP-1 transcription factor subunit
12	9544.ENSMMUP00000006115	0.588	Regulator of calcineurin 1
13	9544.ENSMMUP00000001399	0.567	Belongs to the protein kinase superfamily.
14	9544.ENSMMUP00000034743	0.562	Mediator of RNA polymerase II transcription subunit 13
15	9544.ENSMMUP00000005430	0.547	Mitogen-activated protein kinase 8 isoform JNK1 alpha2
16	9544.ENSMMUP00000028357	0.543	REV3 like, DNA directed polymerase zeta catalytic subunit
17	9544.ENSMMUP00000010941	0.541	Mitogen-activated protein kinase 10 isoform 3
18	9544.ENSMMUP00000030685	0.539	C-type lectin superfamily member 1
19	9544.ENSMMUP00000025371	0.538	Vav 1 guanine nucleotide exchange factor
20	9544.ENSMMUP00000009168	0.531	SRY (sex determining region Y)-box 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	1.000	DNA binding
GO:0043565	0.987	sequence-specific DNA binding
GO:0003690	0.981	double-stranded DNA binding
GO:1990837	0.967	sequence-specific double-stranded DNA binding
GO:0000976	0.948	transcription cis-regulatory region binding
GO:0000981	0.924	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.920	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.915	DNA-binding transcription activator activity
GO:0001228	0.900	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003682	0.873	chromatin binding
GO:0000987	0.862	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.649	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009628	0.990	response to abiotic stimulus
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.975	cellular process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0006950	0.970	response to stress
GO:0048518	0.970	positive regulation of biological process
GO:0080090	0.965	regulation of primary metabolic process
GO:0048522	0.962	positive regulation of cellular process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0010468	0.923	regulation of gene expression
GO:0019219	0.922	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.880	regulation of cellular biosynthetic process
GO:0010556	0.879	regulation of macromolecule biosynthetic process
GO:0051252	0.879	regulation of RNA metabolic process
GO:0010604	0.872	positive regulation of macromolecule metabolic process
GO:0006355	0.840	regulation of DNA-templated transcription
GO:0051173	0.776	positive regulation of nitrogen compound metabolic process
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0006970	0.709	response to osmotic stress
GO:0008152	0.678	metabolic process
GO:0071704	0.669	organic substance metabolic process
GO:0044237	0.658	cellular metabolic process
GO:0045944	0.646	positive regulation of transcription by RNA polymerase II
GO:0051716	0.638	cellular response to stimulus
GO:0023051	0.638	regulation of signaling
GO:0044238	0.635	primary metabolic process
GO:0010646	0.634	regulation of cell communication
GO:0048583	0.618	regulation of response to stimulus
GO:0006807	0.605	nitrogen compound metabolic process
GO:0009966	0.588	regulation of signal transduction
GO:0043170	0.585	macromolecule metabolic process
GO:0042221	0.526	response to chemical
GO:0032501	0.452	multicellular organismal process
GO:1902531	0.359	regulation of intracellular signal transduction
GO:0070887	0.305	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.997	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005829	0.966	cytosol
GO:0016020	0.494	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]