StarFunc result for job id O94921

User Input

>input (469 residues)
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35495	0.697	0.697	1.168E-75	469	0.985	0.985	O35495.pdb.gz	CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus OX=10090 GN=Cdk14 PE=1 SV=2
2	AFDB:Q96Q40	0.662	0.712	7.844E-51	435	0.503	0.543	Q96Q40.pdb.gz	CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens OX=9606 GN=CDK15 PE=1 SV=2
3	AFDB:Q7KM03	0.702	0.633	1.672E-49	522	0.522	0.469	Q7KM03.pdb.gz	Q7KM03_DROME Ecdysone-induced protein 63E, isoform G OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=1 SV=1
4	AFDB:A0A024R183	0.672	0.630	3.397E-42	502	0.454	0.424	A0A024R183.pdb.gz
5	AFDB:Q00537	0.650	0.586	6.465E-41	523	0.461	0.413	Q00537.pdb.gz	CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17 PE=1 SV=2
6	AFDB:Q07002	0.671	0.665	1.429E-40	474	0.450	0.445	Q07002.pdb.gz	CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens OX=9606 GN=CDK18 PE=1 SV=4
7	AFDB:Q8I7M8	0.664	0.471	2.623E-38	667	0.424	0.298	Q8I7M8.pdb.gz	CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans OX=6239 GN=pct-1 PE=1 SV=1
8	AFDB:P34117	0.594	0.944	3.777E-34	292	0.339	0.545	P34117.pdb.gz	CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum OX=44689 GN=cdk5 PE=2 SV=2
9	AFDB:G5EAZ1	0.586	0.743	7.889E-34	366	0.339	0.434	G5EAZ1.pdb.gz	G5EAZ1_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08261 PE=3 SV=1
10	AFDB:A0A1D8PDA6	0.596	0.831	2.187E-33	332	0.337	0.476	A0A1D8PDA6.pdb.gz	A0A1D8PDA6_CANAL Cyclin-dependent serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO85 PE=3 SV=1
11	PDB:4gcjA	0.572	0.866	2.309E-31	304	0.330	0.510	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
12	PDB:4krcA	0.554	0.858	2.586E-31	297	0.328	0.519	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:1unlA	0.549	0.865	3.504E-30	292	0.339	0.545	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:4ek6A	0.545	0.903	9.715E-30	279	0.294	0.495	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	PDB:4yc3A	0.580	0.908	7.057E-29	295	0.303	0.481	4yc3A.pdb.gz
16	PDB:1blxA	0.554	0.833	1.965E-25	305	0.271	0.416	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
17	PDB:4eomC	0.498	0.832	4.105E-25	276	0.296	0.504	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:3mi9A	0.547	0.765	1.895E-24	329	0.243	0.347	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
19	PDB:7cgaA	0.525	0.698	5.675E-23	347	0.217	0.294	7cgaA.pdb.gz
20	PDB:1j1bB	0.539	0.684	4.886E-22	364	0.211	0.272	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35495	0.0	965	469	0.985	0.985	CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus OX=10090 GN=Cdk14 PE=1 SV=2
2	O94921	0.0	978	469	1.000	1.000	CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens OX=9606 GN=CDK14 PE=1 SV=3
3	Q96Q40	3.16e-165	474	435	0.478	0.515	CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens OX=9606 GN=CDK15 PE=1 SV=2
4	Q8MZ44	2.54e-156	449	367	0.473	0.605	Q8MZ44_DROME LD27880p OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
5	Q7KM05	6.35e-155	451	509	0.473	0.436	Q7KM05_DROME Ecdysone-induced protein 63E, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
6	Q7KM04	6.47e-155	451	501	0.473	0.443	Q7KM04_DROME Ecdysone-induced protein 63E, isoform H OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
7	Q9XTK9	7.26e-155	451	522	0.473	0.425	Q9XTK9_DROME Ecdysone-induced protein 63E, isoform D OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=2
8	Q7KM03	7.50e-155	451	522	0.473	0.425	Q7KM03_DROME Ecdysone-induced protein 63E, isoform G OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=1 SV=1
9	Q7KM08	1.06e-154	451	509	0.473	0.436	Q7KM08_DROME Ecdysone-induced protein 63E, isoform F OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
10	M9PE01	2.40e-154	451	538	0.473	0.413	M9PE01_DROME Ecdysone-induced protein 63E, isoform N OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=4 SV=1
11	Q94888	1.34e-153	448	509	0.471	0.434	Q94888_DROME Serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Eip63E PE=2 SV=1
12	Q9BRL4	8.45e-129	382	448	0.409	0.429	Q9BRL4_HUMAN PCTK1 protein OS=Homo sapiens OX=9606 GN=PCTK1 PE=1 SV=1
13	A0A140VK97	4.28e-128	382	496	0.409	0.387	A0A140VK97_HUMAN Testis secretory sperm-binding protein Li 224n OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q00536	4.28e-128	382	496	0.409	0.387	CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1
15	Q04735	1.66e-127	381	496	0.409	0.387	CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus OX=10090 GN=Cdk16 PE=1 SV=1
16	Q63686	6.22e-127	379	496	0.414	0.391	CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus OX=10116 GN=Cdk16 PE=1 SV=1
17	Q00537	3.51e-126	378	523	0.412	0.369	CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17 PE=1 SV=2
18	Q07002	2.72e-124	372	474	0.422	0.418	CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens OX=9606 GN=CDK18 PE=1 SV=4
19	Q8I7M8	3.02e-112	347	667	0.375	0.264	CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans OX=6239 GN=pct-1 PE=1 SV=1
20	E5RGN0	1.70e-103	316	393	0.328	0.392	E5RGN0_HUMAN Cyclin dependent kinase 16 (Fragment) OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.017	25.8	ABC1 atypical kinase-like domain
2	PF01636 APH	81	14.5	Phosphotransferase enzyme family
3	PF13095 FTA2	2.8e+02	12.6	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	0.2	22.2	Haspin like kinase domain
5	PF14531 Kinase-like	53	14.6	Kinase-like
6	PF00069 Pkinase	2.4e-64	228.8	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	1.4e-28	111.5	Protein tyrosine and serine/threonine kinase
8	PF16198 TruB_C_2	4.1e+02	12.5	tRNA pseudouridylate synthase B C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008686

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009557	0.888	This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand
2	60711.ENSCSAP00000007557	0.874	Cyclin Y
3	60711.ENSCSAP00000003587	0.867	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
4	60711.ENSCSAP00000015262	0.851	Involved in the initiation of DNA replication. Also participates in checkpoint controls that ensure DNA replication is completed before mitosis is initiated
5	60711.ENSCSAP00000008212	0.842	Cyclin B2
6	60711.ENSCSAP00000011944	0.842	Cyclin B1
7	60711.ENSCSAP00000007517	0.833	Cyclin D3
8	60711.ENSCSAP00000007054	0.790	Origin recognition complex, subunit 2
9	60711.ENSCSAP00000008936	0.787	Cyclin B3
10	60711.ENSCSAP00000006516	0.781	Protein kinase, membrane associated tyrosine/threonine 1
11	60711.ENSCSAP00000007378	0.754	Fizzy/cell division cycle 20 related 1 (Drosophila)
12	60711.ENSCSAP00000015142	0.754	Chromatin licensing and DNA replication factor 1
13	60711.ENSCSAP00000016832	0.754	Cell division cycle 20
14	60711.ENSCSAP00000010896	0.753	Cyclin H
15	60711.ENSCSAP00000009229	0.750	DNA helicase
16	60711.ENSCSAP00000000102	0.745	Uncharacterized protein
17	60711.ENSCSAP00000016740	0.743	Origin recognition complex, subunit 1
18	60711.ENSCSAP00000010927	0.741	DNA helicase
19	60711.ENSCSAP00000001166	0.731	Cyclin E1
20	60711.ENSCSAP00000002839	0.731	Kinesin family member 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004693	0.889	cyclin-dependent protein serine/threonine kinase activity
GO:0030332	0.855	cyclin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0044770	0.875	cell cycle phase transition
GO:0000278	0.762	mitotic cell cycle
GO:0010646	0.734	regulation of cell communication
GO:0044237	0.731	cellular metabolic process
GO:0006807	0.728	nitrogen compound metabolic process
GO:0071704	0.722	organic substance metabolic process
GO:0044238	0.714	primary metabolic process
GO:0043170	0.713	macromolecule metabolic process
GO:0023051	0.713	regulation of signaling
GO:1903047	0.701	mitotic cell cycle process
GO:0044772	0.654	mitotic cell cycle phase transition
GO:0048518	0.504	positive regulation of biological process
GO:1901564	0.489	organonitrogen compound metabolic process
GO:0006793	0.488	phosphorus metabolic process
GO:0019222	0.449	regulation of metabolic process
GO:0019538	0.434	protein metabolic process
GO:0048583	0.414	regulation of response to stimulus
GO:0060255	0.401	regulation of macromolecule metabolic process
GO:0051171	0.390	regulation of nitrogen compound metabolic process
GO:0031323	0.388	regulation of cellular metabolic process
GO:0080090	0.376	regulation of primary metabolic process
GO:0006796	0.369	phosphate-containing compound metabolic process
GO:0048522	0.342	positive regulation of cellular process
GO:0009966	0.315	regulation of signal transduction
GO:0043412	0.309	macromolecule modification
GO:0044839	0.306	cell cycle G2/M phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0000307	0.997	cyclin-dependent protein kinase holoenzyme complex
GO:0005654	0.997	nucleoplasm
GO:0016020	0.983	membrane
GO:0071944	0.796	cell periphery
GO:0005886	0.752	plasma membrane
GO:0043228	0.675	non-membrane-bounded organelle
GO:0043232	0.674	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.22	0.889	cyclin-dependent kinase.

[back to server]