StarFunc result for job id O94923

User Input

>input (617 residues)
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASE
SNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKF
LTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRK
GVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFL
SEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYER
GMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKE
FVKRWKSYLKGSRAKHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EPS3	0.897	0.896	0.000	618	0.958	0.956	Q9EPS3.pdb.gz	GLCE_MOUSE D-glucuronyl C5-epimerase OS=Mus musculus OX=10090 GN=Glce PE=1 SV=2
2	AFDB:F1QR43	0.832	0.876	6.050E-92	586	0.734	0.773	F1QR43.pdb.gz	GLCEB_DANRE D-glucuronyl C5-epimerase B OS=Danio rerio OX=7955 GN=glceb PE=1 SV=1
3	AFDB:Q29RD8	0.832	0.878	7.580E-88	585	0.681	0.718	Q29RD8.pdb.gz	Q29RD8_DANRE heparosan-N-sulfate-glucuronate 5-epimerase OS=Danio rerio OX=7955 GN=glcel PE=2 SV=1
4	PDB:4pxqA	0.818	0.976	8.341E-83	516	0.669	0.800	4pxqA.pdb.gz	Structural and Functional Study of d-Glucuronyl C5-epimerase.
5	AFDB:A1Z6M8	0.807	0.811	7.911E-62	614	0.415	0.417	A1Z6M8.pdb.gz	A1Z6M8_DROME heparosan-N-sulfate-glucuronate 5-epimerase OS=Drosophila melanogaster OX=7227 GN=Hsepi PE=3 SV=1
6	AFDB:P46555	0.743	0.744	1.489E-50	616	0.355	0.356	P46555.pdb.gz	GLCE_CAEEL D-glucuronyl C5-epimerase OS=Caenorhabditis elegans OX=6239 GN=hse-5 PE=1 SV=2
7	PDB:6ve73	0.235	0.715	4.770E-7	187	0.032	0.107	6ve73.pdb.gz	The inner junction complex of the cilia is an interaction hub that involves tubulin post-translational modifications.
8	PDB:7ungXA	0.227	0.681	6.766E-7	186	0.029	0.097	7ungXA.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
9	AFDB:Q6PL24	0.076	0.113	2.754E-3	325	0.066	0.126	Q6PL24.pdb.gz	TMED8_HUMAN Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1
10	AFDB:Q9VFP2	0.083	0.067	1.171E-2	829	0.120	0.089	Q9VFP2.pdb.gz	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
11	AFDB:F4I316	0.116	0.110	1.430E-2	660	0.107	0.100	F4I316.pdb.gz	SUN3_ARATH SUN domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=SUN3 PE=1 SV=1
12	PDB:4uflA	0.174	0.169	2.809E-2	641	0.031	0.030	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
13	PDB:1fp3A	0.207	0.296	5.114E-2	402	0.045	0.070	1fp3A.pdb.gz
14	AFDB:Q8K1S2	0.067	0.048	5.238E-2	956	0.068	0.044	Q8K1S2.pdb.gz	UNC5D_MOUSE Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1
15	PDB:2byvE	0.096	0.073	8.015E-2	922	0.073	0.049	2byvE.pdb.gz
16	AFDB:P43026	0.076	0.086	8.630E-2	501	0.092	0.114	P43026.pdb.gz	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
17	PDB:6yxxED	0.071	0.072	9.787E-2	598	0.062	0.064	6yxxED.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:7vqoA	0.137	0.084	9.787E-2	1180	0.070	0.036	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
19	PDB:2et1A	0.110	0.262	1.029E-1	201	0.021	0.065	2et1A.pdb.gz	Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
20	PDB:6dhtA	0.166	0.182	1.029E-1	547	0.045	0.051	6dhtA.pdb.gz	A Cell-Surface GH9 Endo-Glucanase Coordinates with Surface Glycan-Binding Proteins to Mediate Xyloglucan Uptake in the Gut Symbiont Bacteroides ovatus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QR43	0.0	928	586	0.726	0.765	GLCEB_DANRE D-glucuronyl C5-epimerase B OS=Danio rerio OX=7955 GN=glceb PE=1 SV=1
2	O18756	0.0	1251	617	0.971	0.971	GLCE_BOVIN D-glucuronyl C5-epimerase OS=Bos taurus OX=9913 GN=GLCE PE=1 SV=2
3	O94923	0.0	1292	617	1.000	1.000	GLCE_HUMAN D-glucuronyl C5-epimerase OS=Homo sapiens OX=9606 GN=GLCE PE=1 SV=3
4	Q29RD8	0.0	888	585	0.681	0.718	Q29RD8_DANRE heparosan-N-sulfate-glucuronate 5-epimerase OS=Danio rerio OX=7955 GN=glcel PE=2 SV=1
5	Q9EPS3	0.0	1243	618	0.959	0.958	GLCE_MOUSE D-glucuronyl C5-epimerase OS=Mus musculus OX=10090 GN=Glce PE=1 SV=2
6	A1Z6M8	8.74e-155	460	614	0.407	0.409	A1Z6M8_DROME heparosan-N-sulfate-glucuronate 5-epimerase OS=Drosophila melanogaster OX=7227 GN=Hsepi PE=3 SV=1
7	P46555	7.93e-111	347	616	0.353	0.354	GLCE_CAEEL D-glucuronyl C5-epimerase OS=Caenorhabditis elegans OX=6239 GN=hse-5 PE=1 SV=2
8	A0A0G2K8F6	3.2	33.5	1021	0.037	0.023	A0A0G2K8F6_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=2
9	A0A8I6AJ32	3.4	33.1	935	0.037	0.025	A0A8I6AJ32_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1
10	B5DEJ3	5.7	32.7	1004	0.037	0.023	B5DEJ3_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=2 SV=1
11	A0A0R4IB93	6.9	32.3	1047	0.057	0.033	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
12	O54782	9.2	32.0	1018	0.036	0.022	MA2B2_MOUSE Epididymis-specific alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b2 PE=1 SV=2
13	Q7TP34	9.2	32.0	1449	0.036	0.015	Q7TP34_RAT Ab2-450 OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06662 C5-epim_C	1.1e-68	241.9	D-glucuronyl C5-epimerase C-terminus
2	PF16332 DUF4962	41	14.1	Domain of unknown function (DUF4962)
3	PF06872 EspG	6e+02	10.4	EspG protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307046	0.969	Syndecan-2
2	9606.ENSP00000359864	0.965	Glypican-4
3	9606.ENSP00000366246	0.962	Glypican-6
4	9606.ENSP00000292377	0.958	Glypican-2
5	9606.ENSP00000264039	0.955	Glypican-1
6	9606.ENSP00000363827	0.955	Basement membrane-specific heparan sulfate proteoglycan core protein
7	9606.ENSP00000377836	0.950	Glypican-3
8	9606.ENSP00000366267	0.943	Glypican-5
9	9606.ENSP00000368678	0.942	Agrin
10	9606.ENSP00000359581	0.940	Heparan sulfate 2-O-sulfotransferase 1
11	9606.ENSP00000344468	0.938	Syndecan-3
12	9606.ENSP00000370542	0.934	Syndecan-1
13	9606.ENSP00000361818	0.925	Syndecan-4
14	9606.ENSP00000259241	0.865	Heparan-sulfate 6-O-sulfotransferase 1
15	9606.ENSP00000359579	0.863	Heparan sulfate 2-O-sulfotransferase 1
16	9606.ENSP00000261797	0.850	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
17	9606.ENSP00000427888	0.828	Heparan sulfate glucosamine 3-O-sulfotransferase 5
18	9606.ENSP00000310657	0.825	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
19	9606.ENSP00000002596	0.816	Heparan sulfate glucosamine 3-O-sulfotransferase 1
20	9606.ENSP00000429473	0.809	Heparan-sulfate 6-O-sulfotransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047464	1.000	heparosan-N-sulfate-glucuronate 5-epimerase activity
GO:0005515	0.973	protein binding
GO:0042802	0.723	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006790	0.995	sulfur compound metabolic process
GO:0015012	0.990	heparan sulfate proteoglycan biosynthetic process
GO:0030203	0.977	glycosaminoglycan metabolic process
GO:0006024	0.970	glycosaminoglycan biosynthetic process
GO:1903510	0.923	mucopolysaccharide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0070013	0.729	intracellular organelle lumen
GO:0005576	0.688	extracellular region
GO:0005615	0.656	extracellular space
GO:1903561	0.556	extracellular vesicle
GO:0070062	0.551	extracellular exosome
GO:0005783	0.537	endoplasmic reticulum
GO:0005634	0.369	nucleus
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20197	1.000	[heparosan-N-sulfate](n) = [heparan-N-sulfate](n)
EC:5.1.3.17	1.000	heparosan-N-sulfate-glucuronate 5-epimerase.

[back to server]