StarFunc result for job id O94953

User Input

>input (1096 residues)
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFL8	0.392	0.392	0.000	1096	0.999	0.999	A0A0C4DFL8.pdb.gz	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	AFDB:F1QNG0	0.410	0.424	0.000	1045	0.491	0.515	F1QNG0.pdb.gz	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
3	AFDB:F1QPD2	0.359	0.281	0.000	1482	0.521	0.385	F1QPD2.pdb.gz
4	AFDB:F5GX28	0.409	0.399	0.000	1130	0.995	0.965	F5GX28.pdb.gz	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
5	AFDB:M0RB75	0.495	0.495	0.000	1099	0.806	0.803	M0RB75.pdb.gz	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
6	AFDB:O75164	0.361	0.370	0.000	1064	0.499	0.514	O75164.pdb.gz	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
7	AFDB:Q8VCD7	0.336	0.349	0.000	1054	0.526	0.547	Q8VCD7.pdb.gz	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
8	AFDB:Q9H3R0	0.472	0.486	0.000	1056	0.519	0.539	Q9H3R0.pdb.gz	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2
9	AFDB:A0A2R8QE74	0.319	0.354	1.066E-103	982	0.455	0.508	A0A2R8QE74.pdb.gz
10	AFDB:Q3U2K5	0.341	0.716	3.528E-60	510	0.257	0.553	Q3U2K5.pdb.gz	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
11	PDB:7yxgA	0.148	0.433	4.393E-7	313	0.036	0.128	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
12	PDB:3al5C	0.141	0.439	6.793E-7	284	0.040	0.155	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:3al5B	0.160	0.472	9.948E-7	311	0.043	0.151	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	PDB:4qszA	0.143	0.217	8.796E-6	686	0.026	0.041	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
15	PDB:5nfnB	0.147	0.422	8.796E-6	318	0.027	0.094	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
16	PDB:4b7eA	0.150	0.403	1.036E-5	349	0.030	0.095	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
17	PDB:4cclB	0.116	0.283	1.123E-3	372	0.024	0.070	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:6imcD	0.080	0.214	1.186E-3	340	0.025	0.079	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.
19	PDB:4bxfA	0.118	0.258	1.475E-3	425	0.026	0.068	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:2fdjA	0.075	0.324	2.045E-3	207	0.013	0.068	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFL8	2274	1096	0.999	0.999	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
2	A0A0G2JXG2	1768	1086	0.807	0.815	A0A0G2JXG2_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=2
3	A0A0G2K5I7	620	1062	0.252	0.260	A0A0G2K5I7_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4a PE=3 SV=1
4	A0A8I5ZWQ3	1683	1055	0.770	0.800	A0A8I5ZWQ3_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
5	A0A8I6A8Y8	648	1009	0.266	0.288	A0A8I6A8Y8_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=1
6	A0A8I6GK41	1574	1021	0.741	0.795	A0A8I6GK41_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
7	A2RRT0	641	1482	0.274	0.202	A2RRT0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=wu:fd55d07 PE=2 SV=1
8	B2RXH2	552	506	0.231	0.500	KDM4E_HUMAN Lysine-specific demethylase 4E OS=Homo sapiens OX=9606 GN=KDM4E PE=1 SV=1
9	F1LS62	638	1050	0.263	0.274	F1LS62_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4c PE=3 SV=4
10	F1QNG0	600	1045	0.243	0.255	F1QNG0_DANRE [histone H3]-trimethyl-L-lysine(9) demethylase OS=Danio rerio OX=7955 GN=kdm4ab PE=3 SV=2
11	F5GX28	2257	1130	0.999	0.969	F5GX28_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=2
12	M0RB75	1767	1099	0.810	0.808	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
13	O75164	620	1064	0.253	0.260	KDM4A_HUMAN Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2
14	O94953	2275	1096	1.000	1.000	KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=4
15	Q3U2K5	584	510	0.239	0.514	KDM4D_MOUSE Lysine-specific demethylase 4D OS=Mus musculus OX=10090 GN=Kdm4d PE=2 SV=2
16	Q6B0I6	577	523	0.240	0.503	KDM4D_HUMAN Lysine-specific demethylase 4D OS=Homo sapiens OX=9606 GN=KDM4D PE=1 SV=3
17	Q8BW72	618	1064	0.248	0.256	KDM4A_MOUSE Lysine-specific demethylase 4A OS=Mus musculus OX=10090 GN=Kdm4a PE=1 SV=3
18	Q8VCD7	648	1054	0.271	0.282	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
19	Q91VY5	1768	1086	0.805	0.812	KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus OX=10090 GN=Kdm4b PE=2 SV=1
20	Q9H3R0	655	1056	0.270	0.280	KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens OX=9606 GN=KDM4C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09038 53-BP1_Tudor	68	14.9	Tumour suppressor p53-binding protein-1 Tudor
2	PF15057 DUF4537	13	17.1	Domain of unknown function (DUF4537)
3	PF02373 JmjC	9.4e-40	147.0	JmjC domain, hydroxylase
4	PF02375 JmjN	2.7e-11	54.4	jmjN domain
5	PF09465 LBR_tudor	2	19.5	Lamin-B receptor of TUDOR domain
6	PF00628 PHD	0.078	24.2	PHD-finger
7	PF13831 PHD_2	4.2e-11	53.4	PHD-finger
8	PF18104 Tudor_2	2.4e-27	105.6	Jumonji domain-containing protein 2A Tudor domain
9	PF18115 Tudor_3	9.4	17.5	DNA repair protein Crb2 Tudor domain
10	PF13771 zf-HC5HC2H	4.5e-15	67.0	PHD-like zinc-binding domain
11	PF13832 zf-HC5HC2H_2	2e-33	126.2	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000159111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301067	0.978	Histone-lysine N-methyltransferase 2D
2	9606.ENSP00000361473	0.965	Lysine-specific demethylase 4A
3	9606.ENSP00000405330	0.944	Estrogen receptor
4	9606.ENSP00000382204	0.916	Probable JmjC domain-containing histone demethylation protein 2C
5	9606.ENSP00000348056	0.903	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000304697	0.902	Polyubiquitin-B
8	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
9	9606.ENSP00000441543	0.902	Polyubiquitin-C
10	9606.ENSP00000305422	0.874	CCAAT/enhancer-binding protein beta
11	9606.ENSP00000281043	0.831	N-myc proto-oncogene protein
12	9606.ENSP00000344456	0.831	Catenin beta-1
13	9606.ENSP00000340330	0.789	Histone acetyltransferase KAT5
14	9606.ENSP00000398837	0.784	Histone-lysine N-methyltransferase 2B
15	9606.ENSP00000386660	0.778	Lysine-specific demethylase 3A
16	9606.ENSP00000254846	0.777	Lysine-specific demethylase 6B
17	9606.ENSP00000395654	0.760	Transcription activator BRG1
18	9606.ENSP00000372351	0.758	Histone-lysine N-methyltransferase NSD2
19	9606.ENSP00000380692	0.747	Lysine-specific demethylase 7A
20	9606.ENSP00000383042	0.746	Lysine-specific histone demethylase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016706	1.000	2-oxoglutarate-dependent dioxygenase activity
GO:0032454	1.000	histone H3K9 demethylase activity
GO:0005515	0.995	protein binding
GO:0019899	0.785	enzyme binding
GO:0051864	0.675	histone H3K36 demethylase activity
GO:0008134	0.563	transcription factor binding
GO:0140684	0.502	histone H3K9me2/H3K9me3 demethylase activity
GO:0097159	0.418	organic cyclic compound binding
GO:0003676	0.409	nucleic acid binding
GO:0140297	0.398	DNA-binding transcription factor binding
GO:0061629	0.338	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0043167	0.318	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0019222	0.829	regulation of metabolic process
GO:0060255	0.822	regulation of macromolecule metabolic process
GO:0032502	0.791	developmental process
GO:0051171	0.773	regulation of nitrogen compound metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0031323	0.771	regulation of cellular metabolic process
GO:0048518	0.761	positive regulation of biological process
GO:0048856	0.706	anatomical structure development
GO:0010468	0.601	regulation of gene expression
GO:0048522	0.595	positive regulation of cellular process
GO:0010604	0.546	positive regulation of macromolecule metabolic process
GO:0019219	0.539	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.529	multicellular organismal process
GO:0048519	0.496	negative regulation of biological process
GO:0009987	0.481	cellular process
GO:0050896	0.438	response to stimulus
GO:0031326	0.428	regulation of cellular biosynthetic process
GO:0048523	0.415	negative regulation of cellular process
GO:0010556	0.409	regulation of macromolecule biosynthetic process
GO:0007275	0.353	multicellular organism development
GO:0071704	0.352	organic substance metabolic process
GO:0051252	0.331	regulation of RNA metabolic process
GO:2001141	0.314	regulation of RNA biosynthetic process
GO:0044238	0.309	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.953	cytosol
GO:0043232	0.680	intracellular non-membrane-bounded organelle
GO:0032991	0.438	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:60200	0.502	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(9)-[histone H3] + 2 succinate
EC:1.14.11.66	0.502	[histone H3]-trimethyl-L-lysine(9) demethylase.

[back to server]