StarFunc result for job id O94964

User Input

>input (1423 residues)
MLEMRDVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERRSLRAAQTGQVDGELIRG
LEQDVKVSKDISMRLHKELEVVEKKRARLEEENEELRQRLIETELAKQVLQTELERPREH
SLKKRGTRSLGKADKKTLVQEDSADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLK
YRSLYGDLDSALSAEELADAPHSRETELKVHLKLVEEEANLLSRRIVELEVENRGLRAEM
DDMKDHGGGCGGPEARLAFSALGGGECGESLAELRRHLQFVEEEAELLRRSSAELEDQNK
LLLNELAKFRSEHELDVALSEDSCSVLSEPSQEELAAAKLQIGELSGKVKKLQYENRVLL
SNLQRCDLASCQSTRPMLETDAEAGDSAQCVPAPLGETHESHAVRLCRAREAEVLPGLRE
QAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLS
VLQQELNAFTRKADAVLGCSVKEQQESFSSLPPLGSQGLSKEILLAKDLGSDFQPPDFRD
LPEWEPRIREAFRTGDLDSKPDPSRSFRPYRAEDNDSYASEIKELQLVLAEAHDSLRGLQ
EQLSQERQLRKEEADNFNQKMVQLKEDQQRALLRREFELQSLSLQRRLEQKFWSQEKNML
VQESQQFKHNFLLLFMKLRWFLKRWRQGKVLPSEGDDFLEVNSMKELYLLMEEEEINAQH
SDNKACTGDSWTQNTPNEYIKTLADMKVTLKELCWLLRDERRGLTELQQQFAKAKATWET
ERAELKGHTSQMELKTGKGAGERAGPDWKAALQREREEQQHLLAESYSAVMELTRQLQIS
ERNWSQEKLQLVERLQGEKQQVEQQVKELQNRLSQLQKAADPWVLKHSELEKQDNSWKET
RSEKIHDKEAVSEVELGGNGLKRTKSVSSMSEFESLLDCSPYLAGGDARGKKLPNNPAFG
FVSSEPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRVYYSPPV
ARRLGVPVVHDKEGKIIIEPGFLFTTAKPKESAEADGLAESSYGRWLCNFSRQRLDGGSA
GSPSAAGPGFPAALHDFEMSGNMSDDMKEITNCVRQAMRSGSLERKVKSTSSQTVGLASV
GTQTIRTVSVGLQTDPPRSSLHGKAWSPRSSSLVSVRSKQISSSLDKVHSRIERPCCSPK
YGSPKLQRRSVSKLDSSKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSV
VEHSGSTESVWKLGMSETRAKPEPPKYGIVQEFFRNVCGRAPSPTSSAGEEGTKKPEPLS
PASYHQPEGVARILNKKAAKLGSSEEVRLTMLPQVGKDGVLRDGDGAVVLPNEDAVCDCS
TQSLTSCFARSSRSAIRHSPSKCRLHPSESSWGGEERALPPSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94964	0.999	0.999	0.000	1423	1.000	1.000	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
2	AFDB:Q3UHU5	0.094	0.072	1.210E-50	1945	0.384	0.281	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
3	AFDB:P48681	0.054	0.049	8.798E-14	1621	0.163	0.143	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
4	AFDB:P85120	0.058	0.043	6.351E-13	2058	0.175	0.121	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
5	AFDB:F4HRT5	0.058	0.071	2.019E-11	1132	0.128	0.161	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
6	AFDB:Q9SAF6	0.046	0.058	2.750E-11	1128	0.134	0.169	Q9SAF6.pdb.gz	CRWN2_ARATH Protein CROWDED NUCLEI 2 OS=Arabidopsis thaliana OX=3702 GN=CRWN2 PE=1 SV=1
7	AFDB:Q0DY81	0.071	0.085	1.006E-10	1155	0.136	0.168	Q0DY81.pdb.gz	NMCPA_ORYSJ Nuclear matrix constituent protein 1a OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1A PE=2 SV=1
8	AFDB:Q585C9	0.093	0.101	1.371E-10	1271	0.150	0.168	Q585C9.pdb.gz	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1
9	AFDB:Q6P5H2	0.051	0.041	1.458E-10	1864	0.181	0.138	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
10	AFDB:Q387T9	0.055	0.046	5.015E-10	1748	0.136	0.110	Q387T9.pdb.gz	Q387T9_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0560 PE=4 SV=1
11	PDB:7rroB0	0.047	0.237	1.418	189	0.018	0.132	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7ungB0	0.054	0.348	2.185	193	0.016	0.119	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:2zdiC	0.043	0.295	3.367	148	0.011	0.101	2zdiC.pdb.gz
14	PDB:6jbjA	0.047	0.114	3.582	565	0.011	0.027	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
15	PDB:7vwcA	0.047	0.105	5.189	617	0.012	0.028	7vwcA.pdb.gz
16	PDB:3mxzA	0.048	0.543	5.871	107	0.009	0.121	3mxzA.pdb.gz
17	PDB:7z37DP1	0.044	0.163	6.245	273	0.015	0.081	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
18	PDB:6u424R	0.053	0.154	6.643	366	0.049	0.191	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
19	PDB:7r5jV0	0.038	0.180	6.643	273	0.027	0.143	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:1rprA	0.037	0.640	7.066	63	0.006	0.127	1rprA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1U8D0	0.0	2590	1418	0.919	0.922	SOGA1_MOUSE Protein SOGA1 OS=Mus musculus OX=10090 GN=Soga1 PE=1 SV=3
2	O94964	0.0	2902	1423	1.000	1.000	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
3	Q3UHU5	0.0	701	1945	0.410	0.300	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
4	Q9Y4B5	6.45e-164	542	1905	0.269	0.201	MTCL1_HUMAN Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5
5	Q92351	0.007	43.5	1208	0.058	0.068	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
6	Q5SNZ0	0.059	40.4	1873	0.048	0.036	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
7	Q6ZU52	0.15	38.9	694	0.011	0.023	K0408_HUMAN Uncharacterized protein KIAA0408 OS=Homo sapiens OX=9606 GN=KIAA0408 PE=1 SV=1
8	A0A8I6A5W7	0.22	38.5	1873	0.048	0.036	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
9	A0A8I5ZW24	0.25	38.5	1845	0.048	0.037	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
10	Q3V6T2	0.32	38.1	1871	0.047	0.036	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
11	O75037	0.52	37.4	1637	0.022	0.019	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
12	Q9QXL1	0.58	37.4	1668	0.022	0.019	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
13	H0YFY6	1.2	36.2	964	0.037	0.055	H0YFY6_HUMAN Nuclear mitotic apparatus protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=1
14	Q8IZ41	1.9	35.4	740	0.020	0.038	RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1
15	E7F7G2	2.8	34.7	547	0.039	0.101	E7F7G2_DANRE Coiled-coil domain-containing 78 OS=Danio rerio OX=7955 GN=ccdc78 PE=4 SV=1
16	A2AL36	3.2	34.7	2334	0.022	0.013	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
17	Q4G051	3.2	34.7	638	0.032	0.071	Q4G051_RAT Numa1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Numa1 PE=2 SV=1
18	F7FF45	4.8	34.3	2086	0.038	0.026	F7FF45_RAT Nuclear mitotic apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Numa1 PE=1 SV=3
19	A0A8I6AMK5	4.9	34.3	2092	0.039	0.027	A0A8I6AMK5_RAT Nuclear mitotic apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Numa1 PE=1 SV=1
20	Q9BQS8	5.9	33.9	1478	0.029	0.028	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14818 DUF4482	2.4e-25	101.4	Domain of unknown function (DUF4482)
2	PF11365 SOGA	2.3e-49	177.7	Protein SOGA
3	PF01166 TSC22	4.3e+02	12.5	TSC-22/dip/bun family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237536

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000423505	0.798	Tetratricopeptide repeat domain containing
2	9606.ENSP00000376335	0.776	Integral membrane protein GPR155
3	9606.ENSP00000373206	0.722	EGF domain-specific O-linked N-acetylglucosamine transferase
4	9606.ENSP00000389814	0.703	Adiponectin
5	9606.ENSP00000251119	0.692	Zinc finger FYVE domain-containing protein 26
6	9606.ENSP00000376609	0.541	G protein-coupled receptor kinase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.986	regulation of biological process
GO:0051716	0.978	cellular response to stimulus
GO:0050794	0.973	regulation of cellular process
GO:0019222	0.881	regulation of metabolic process
GO:0048519	0.837	negative regulation of biological process
GO:0031323	0.714	regulation of cellular metabolic process
GO:0048523	0.664	negative regulation of cellular process
GO:0009894	0.649	regulation of catabolic process
GO:0023052	0.640	signaling
GO:0007154	0.640	cell communication
GO:0010506	0.598	regulation of autophagy
GO:0009889	0.567	regulation of biosynthetic process
GO:0080090	0.558	regulation of primary metabolic process
GO:0031326	0.507	regulation of cellular biosynthetic process
GO:0007165	0.496	signal transduction
GO:0009892	0.473	negative regulation of metabolic process
GO:0062012	0.436	regulation of small molecule metabolic process
GO:0031324	0.436	negative regulation of cellular metabolic process
GO:0042221	0.425	response to chemical
GO:0010675	0.394	regulation of cellular carbohydrate metabolic process
GO:0031327	0.386	negative regulation of cellular biosynthetic process
GO:0007166	0.384	cell surface receptor signaling pathway
GO:0007167	0.367	enzyme-linked receptor protein signaling pathway
GO:0010906	0.355	regulation of glucose metabolic process
GO:0062014	0.347	negative regulation of small molecule metabolic process
GO:0032869	0.345	cellular response to insulin stimulus
GO:0045912	0.338	negative regulation of carbohydrate metabolic process
GO:0006111	0.338	regulation of gluconeogenesis
GO:0007169	0.329	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010677	0.312	negative regulation of cellular carbohydrate metabolic process
GO:0008286	0.307	insulin receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.991	membrane-bounded organelle
GO:0005622	0.741	intracellular anatomical structure
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0031982	0.724	vesicle
GO:0043230	0.723	extracellular organelle
GO:1903561	0.707	extracellular vesicle
GO:0070062	0.702	extracellular exosome
GO:0005737	0.669	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]