StarFunc result for job id O94966

User Input

>input (1318 residues)
MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKETGSRYVAQAGLEPLASGD
PSASASHAAGITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPTPELLLDW
RQSAEEVIVKLRVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTR
KGSLLHLTLPKKVPMLTWPSLLVEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGN
DPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVH
VYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCT
FCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQE
EARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDS
VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPL
GTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGL
HEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCA
KVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQS
VHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLSSELAKERVVVLEVQQR
PQVPSVPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGY
PFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTGSLEA
GDSERDPIQPPELQLVTPMAEGDTGLPRVWAAPDRGPVPSTSGISSEMLASGPIEVGSLP
AGERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDSSNREQRLEDKGDTPLELGDDCSLA
LVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWY
CPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIG
QKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQ
VVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAEAAASQASRIWQELEAEEEPVPE
GSGPLGPWGPQDWVGPLPRGPTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94966	1.000	1.000	0.000	1318	1.000	1.000	O94966.pdb.gz	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
2	AFDB:Q3UJD6	0.610	0.592	0.000	1360	0.869	0.843	Q3UJD6.pdb.gz	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
3	AFDB:A1LPW7	0.295	0.376	1.007E-66	963	0.209	0.286	A1LPW7.pdb.gz
4	AFDB:A0A024R2X6	0.293	0.393	6.037E-66	916	0.197	0.283	A0A024R2X6.pdb.gz
5	AFDB:Q8R5H1	0.314	0.397	6.575E-65	981	0.197	0.265	Q8R5H1.pdb.gz	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
6	AFDB:Q9R085	0.291	0.377	1.406E-64	952	0.193	0.268	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
7	AFDB:Q5D006	0.281	0.386	2.257E-61	921	0.191	0.274	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
8	AFDB:P51784	0.277	0.372	3.300E-61	963	0.188	0.258	P51784.pdb.gz	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
9	AFDB:O22207	0.341	0.463	1.186E-59	924	0.186	0.265	O22207.pdb.gz	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
10	AFDB:O60079	0.285	0.362	3.768E-55	979	0.184	0.248	O60079.pdb.gz	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
11	PDB:5cvnB	0.200	0.756	2.199E-16	321	0.072	0.296	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:3mhsA	0.203	0.552	1.061E-15	455	0.069	0.200	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5k16B	0.200	0.737	7.725E-14	328	0.075	0.302	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:4fjcE	0.095	0.268	1.665E-11	434	0.038	0.115	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	PDB:8a9kD	0.101	0.424	2.184E-11	285	0.035	0.161	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
16	PDB:7yxxA	0.100	0.076	3.193E-11	1754	0.042	0.032	7yxxA.pdb.gz
17	PDB:7ay1D	0.105	0.378	3.560E-11	341	0.038	0.147	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:4wa6D	0.091	0.281	8.956E-11	415	0.033	0.106	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:3ihpB	0.196	0.362	1.772E-9	681	0.072	0.140	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
20	PDB:7w3ax	0.194	0.486	2.532E-8	494	0.067	0.178	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RCS0	0.0	1390	1436	0.531	0.487	F1RCS0_DANRE Ubiquitin carboxyl-terminal hydrolase 19 isoform X3 OS=Danio rerio OX=7955 GN=usp19 PE=1 SV=1
2	O94966	0.0	2718	1318	1.000	1.000	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
3	Q3UJD6	0.0	2051	1360	0.785	0.761	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
4	Q6J1Y9	0.0	2076	1357	0.785	0.763	UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus OX=10116 GN=Usp19 PE=1 SV=1
5	Q9Y4E8	1.11e-113	382	981	0.196	0.263	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
6	Q8R5H1	2.56e-113	381	981	0.194	0.261	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
7	Q9R085	2.57e-113	380	952	0.197	0.272	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
8	Q13107	7.98e-79	283	963	0.104	0.142	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
9	P35123	1.05e-76	277	962	0.103	0.141	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
10	G5E9A6	4.09e-73	265	920	0.115	0.165	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
11	P51784	7.40e-73	265	963	0.115	0.158	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
12	E7EZD6	1.04e-71	263	1009	0.095	0.124	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
13	Q5D006	1.22e-70	258	921	0.112	0.161	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
14	H7C189	2.06e-70	251	621	0.097	0.206	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
15	O22207	5.10e-69	253	924	0.100	0.143	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
16	O60079	2.54e-63	237	979	0.096	0.130	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
17	P35125	6.26e-53	206	1406	0.080	0.075	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
18	K7EQL6	6.75e-53	206	1274	0.080	0.083	K7EQL6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
19	Q8NFA0	1.45e-52	205	1604	0.080	0.066	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
20	Q9USM5	1.40e-50	196	849	0.074	0.114	UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04969 CS	7.8e-16	70.2	CS domain
2	PF18115 Tudor_3	4.7e+02	12.1	DNA repair protein Crb2 Tudor domain
3	PF00443 UCH	2.6e-81	284.8	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	3.6e-06	38.4	Ubiquitin carboxyl-terminal hydrolase
5	PF16602 USP19_linker	1.6e-46	169.2	Linker region of USP19 deubiquitinase
6	PF14533 USP7_C2	1.8	19.7	Ubiquitin-specific protease C-terminal
7	PF01753 zf-MYND	0.00012	33.4	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000046154

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013820	0.945	E3 ubiquitin-protein ligase
2	9598.ENSPTRP00000058433	0.805	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity which is essential for its chaperone activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Engages with a range of client protein classes via [...]
3	9598.ENSPTRP00000007250	0.779	Baculoviral IAP repeat containing 3
4	9598.ENSPTRP00000010887	0.745	Uncharacterized protein
5	9598.ENSPTRP00000026453	0.698	Uncharacterized protein
6	9598.ENSPTRP00000007251	0.676	Baculoviral IAP repeat containing 2
7	9598.ENSPTRP00000031135	0.657	Heat shock protein 90kDa alpha (cytosolic), class B member 1
8	9598.ENSPTRP00000025748	0.656	Kelch domain containing 8B
9	9598.ENSPTRP00000002996	0.652	Ubiquitin carboxyl-terminal hydrolase
10	9598.ENSPTRP00000057125	0.640	Uncharacterized protein
11	9598.ENSPTRP00000012875	0.627	2,4-dienoyl CoA reductase 2, peroxisomal
12	9598.ENSPTRP00000007384	0.607	Ubiquitin specific peptidase 28
13	9598.ENSPTRP00000010670	0.606	Trafficking protein particle complex 6B
14	9598.ENSPTRP00000053806	0.603	Uncharacterized protein
15	9598.ENSPTRP00000003693	0.595	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
16	9598.ENSPTRP00000026742	0.589	E3 ubiquitin-protein ligase
17	9598.ENSPTRP00000020413	0.586	Endothelial PAS domain protein 1
18	9598.ENSPTRP00000040609	0.582	Uncharacterized protein
19	9598.ENSPTRP00000051558	0.577	Uncharacterized protein
20	9598.ENSPTRP00000042217	0.571	RAB11 family interacting protein 3 (class II)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0051879	0.999	Hsp90 protein binding
GO:0019899	0.957	enzyme binding
GO:1990380	0.573	K48-linked deubiquitinase activity
GO:0044389	0.554	ubiquitin-like protein ligase binding
GO:0031625	0.538	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0008152	0.997	metabolic process
GO:0050789	0.989	regulation of biological process
GO:0036211	0.986	protein modification process
GO:0006508	0.985	proteolysis
GO:0016579	0.984	protein deubiquitination
GO:0044237	0.927	cellular metabolic process
GO:0031647	0.885	regulation of protein stability
GO:0048519	0.833	negative regulation of biological process
GO:0009056	0.783	catabolic process
GO:0044248	0.774	cellular catabolic process
GO:0050794	0.725	regulation of cellular process
GO:0019222	0.606	regulation of metabolic process
GO:0051171	0.604	regulation of nitrogen compound metabolic process
GO:0080090	0.595	regulation of primary metabolic process
GO:0060255	0.591	regulation of macromolecule metabolic process
GO:0050896	0.444	response to stimulus
GO:0044260	0.366	cellular macromolecule metabolic process
GO:0030162	0.355	regulation of proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043227	0.998	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0016020	0.991	membrane
GO:0031090	0.815	organelle membrane
GO:0031984	0.654	organelle subcompartment
GO:0042175	0.650	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005783	0.572	endoplasmic reticulum
GO:0005789	0.526	endoplasmic reticulum membrane
GO:0032991	0.508	protein-containing complex
GO:0005634	0.481	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]