StarFunc result for job id O94972

User Input

>input (964 residues)
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM
LLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASS
TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR
THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQR
KQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA
LAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRRAVDP
GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM
SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE
NSGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94972	1.000	1.000	0.000	964	1.000	1.000	O94972.pdb.gz	TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens OX=9606 GN=TRIM37 PE=1 SV=2
2	PDB:7z36B	0.145	0.275	1.120E-7	446	0.055	0.119	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
3	AFDB:A0A0B4LFW8	0.092	0.074	2.588E-7	1277	0.143	0.108	A0A0B4LFW8.pdb.gz	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
4	AFDB:A0A0B4LFP7	0.097	0.078	4.585E-7	1248	0.151	0.117	A0A0B4LFP7.pdb.gz	A0A0B4LFP7_DROME Thin, isoform D OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
5	AFDB:B7YZK8	0.099	0.068	5.141E-7	1517	0.174	0.111	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
6	AFDB:Q8RY18	0.129	0.119	8.602E-7	1055	0.126	0.115	Q8RY18.pdb.gz	TRF1A_ARATH TNF receptor-associated factor homolog 1a OS=Arabidopsis thaliana OX=3702 GN=TRAF1A PE=1 SV=1
7	PDB:4tn3B	0.115	0.221	3.361E-4	362	0.049	0.130	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
8	AFDB:A0T1Z4	0.064	0.066	1.299E-3	932	0.098	0.101	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
9	PDB:5dkaA	0.065	0.586	3.310E-3	96	0.023	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
10	PDB:3m62A	0.072	0.072	3.930E-3	955	0.017	0.017	3m62A.pdb.gz
11	PDB:2c2lA	0.068	0.223	4.665E-3	281	0.017	0.057	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
12	AFDB:Q8ND83	0.044	0.063	6.821E-3	568	0.081	0.137	Q8ND83.pdb.gz	SLAI1_HUMAN SLAIN motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SLAIN1 PE=1 SV=3
13	PDB:4r8pL	0.073	0.264	1.233E-2	254	0.019	0.071	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:7qcdC	0.064	0.196	1.233E-2	267	0.012	0.045	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:3t6qC	0.046	0.179	1.464E-2	139	0.019	0.129	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7dvq9	0.053	0.122	2.185E-2	409	0.050	0.117	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:5lj5t	0.051	0.113	3.079E-2	438	0.013	0.030	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	AFDB:O60566	0.044	0.041	3.792E-2	1050	0.084	0.077	O60566.pdb.gz	BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3
19	AFDB:B7SY83	0.056	0.041	5.048E-2	1477	0.093	0.061	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
20	AFDB:F1LYX9	0.045	0.041	5.345E-2	1128	0.099	0.084	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94972	0.0	2004	964	1.000	1.000	TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens OX=9606 GN=TRIM37 PE=1 SV=2
2	Q6PCX9	0.0	1725	961	0.925	0.928	TRI37_MOUSE E3 ubiquitin-protein ligase TRIM37 OS=Mus musculus OX=10090 GN=Trim37 PE=1 SV=1
3	E7F1U3	9.40e-11	68.2	774	0.067	0.084	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
4	D3ZQG6	1.67e-09	64.3	744	0.060	0.078	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
5	Q5SZ99	2.12e-09	63.5	471	0.065	0.134	TRI38_MOUSE E3 ubiquitin-protein ligase TRIM38 OS=Mus musculus OX=10090 GN=Trim38 PE=1 SV=1
6	Q9ESN6	2.27e-09	63.9	744	0.060	0.078	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
7	Q9C040	2.60e-09	63.5	744	0.060	0.078	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
8	A0A024RCP5	2.91e-09	63.2	518	0.050	0.093	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
9	Q9HCM9	2.91e-09	63.2	518	0.050	0.093	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
10	Q0PF16	1.30e-08	60.8	497	0.063	0.123	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
11	A0A096LP39	1.88e-08	60.5	503	0.050	0.095	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
12	Q5C8U4	2.28e-08	60.1	515	0.067	0.126	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
13	Q8C7M3	3.57e-08	60.1	817	0.062	0.073	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
14	Q5C8U3	4.47e-08	59.3	515	0.067	0.126	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
15	Q9C026	4.97e-08	59.3	710	0.062	0.085	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
16	Q587N6	5.22e-08	58.9	495	0.068	0.133	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
17	Q3U7K7	6.39e-08	58.5	462	0.065	0.136	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
18	Q91ZY8	7.11e-08	58.9	710	0.062	0.085	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
19	Q62191	7.94e-08	58.5	470	0.065	0.134	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
20	Q9R1R2	2.17e-07	57.4	744	0.065	0.085	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12700 HlyD_2	29	14.9	HlyD family secretion protein
2	PF00917 MATH	7.7e-05	34.2	MATH domain
3	PF15155 MRFAP1	2.9e+02	13.4	MORF4 family-associated protein1
4	PF00643 zf-B_box	1.1e-05	36.8	B-box zinc finger
5	PF13923 zf-C3HC4_2	35	15.6	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.12	23.6	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262294

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391601	0.733	Peroxisomal targeting signal 1 receptor
2	9606.ENSP00000248633	0.724	Peroxisome biogenesis factor 1
3	9606.ENSP00000315680	0.723	Peroxisomal targeting signal 2 receptor
4	9606.ENSP00000433623	0.656	TNF receptor-associated factor 6
5	9606.ENSP00000348632	0.641	RanBP-type and C3HC4-type zinc finger-containing protein 1
6	9606.ENSP00000348299	0.620	E3 ubiquitin-protein ligase TRIM13
7	9606.ENSP00000381717	0.617	Ubiquitin-conjugating enzyme E2 D2
8	9606.ENSP00000231524	0.613	E3 ubiquitin-protein ligase TRIM23
9	9606.ENSP00000362994	0.611	TNF receptor-associated factor 1
10	9606.ENSP00000291416	0.608	E3 ubiquitin-protein ligase TRIM62
11	9606.ENSP00000280098	0.604	Speckle-type POZ protein-like
12	9606.ENSP00000295756	0.601	T-cell receptor-associated transmembrane adapter 1
13	9606.ENSP00000408292	0.594	E3 ubiquitin-protein ligase TRIM32
14	9606.ENSP00000344456	0.580	Catenin beta-1
15	9606.ENSP00000263182	0.577	Gamma-butyrobetaine dioxygenase
16	9606.ENSP00000312678	0.558	E3 ubiquitin-protein ligase Midline-1
17	9606.ENSP00000430493	0.545	CCR4-NOT transcription complex subunit 8
18	9606.ENSP00000333433	0.539	Spindle and kinetochore-associated protein 2
19	9606.ENSP00000284551	0.532	E3 ubiquitin-protein ligase TRIM11
20	9606.ENSP00000384876	0.532	Tripartite motif-containing protein 66

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0061630	0.998	ubiquitin protein ligase activity
GO:0031625	0.991	ubiquitin protein ligase binding
GO:0140110	0.988	transcription regulator activity
GO:0042802	0.985	identical protein binding
GO:0032813	0.985	tumor necrosis factor receptor superfamily binding
GO:0003713	0.981	transcription coactivator activity
GO:0042803	0.966	protein homodimerization activity
GO:0005164	0.918	tumor necrosis factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0070647	0.975	protein modification by small protein conjugation or removal
GO:0016567	0.969	protein ubiquitination
GO:0050794	0.948	regulation of cellular process
GO:0009987	0.943	cellular process
GO:0006513	0.916	protein monoubiquitination
GO:0016574	0.888	histone ubiquitination
GO:0051171	0.843	regulation of nitrogen compound metabolic process
GO:0080090	0.804	regulation of primary metabolic process
GO:0060255	0.795	regulation of macromolecule metabolic process
GO:0031323	0.786	regulation of cellular metabolic process
GO:0019219	0.769	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.749	regulation of RNA metabolic process
GO:0006355	0.706	regulation of DNA-templated transcription
GO:0048519	0.559	negative regulation of biological process
GO:0048523	0.529	negative regulation of cellular process
GO:0071840	0.519	cellular component organization or biogenesis
GO:0016043	0.467	cellular component organization
GO:0065009	0.439	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0031974	0.995	membrane-enclosed lumen
GO:0005829	0.991	cytosol
GO:0005777	0.988	peroxisome
GO:0070013	0.980	intracellular organelle lumen
GO:0005654	0.971	nucleoplasm
GO:0032991	0.939	protein-containing complex
GO:1990234	0.922	transferase complex
GO:0031090	0.867	organelle membrane
GO:0005778	0.839	peroxisomal membrane
GO:0031519	0.792	PcG protein complex
GO:0035097	0.780	histone methyltransferase complex
GO:0035098	0.754	ESC/E(Z) complex
GO:0016235	0.746	aggresome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]