StarFunc result for job id O94979

User Input

>input (1220 residues)
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVN
FEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLL
GEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDL
IEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIM
QLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVA
PPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGA
PPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPI
TSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFS
KPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTK
RKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSE
TSAFMPVLKVVLTQANKLGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDH6	0.604	0.624	0.000	1181	0.968	1.000	A0A024RDH6.pdb.gz
2	AFDB:D6REX3	0.645	0.630	0.000	1251	1.000	0.975	D6REX3.pdb.gz	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
3	AFDB:Q3UPL0	0.797	0.791	0.000	1230	0.916	0.908	Q3UPL0.pdb.gz	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
4	AFDB:Q7SYD5	0.707	0.689	0.000	1254	0.630	0.612	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
5	AFDB:Q9NQW1	0.704	0.727	5.124E-100	1179	0.480	0.496	Q9NQW1.pdb.gz	SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens OX=9606 GN=SEC31B PE=1 SV=1
6	AFDB:A0A0B4LEZ1	0.565	0.548	4.238E-80	1260	0.356	0.344	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
7	AFDB:A1Z7J7	0.548	0.540	9.293E-78	1240	0.352	0.347	A1Z7J7.pdb.gz	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
8	AFDB:O13637	0.502	0.500	1.541E-55	1224	0.248	0.248	O13637.pdb.gz	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
9	AFDB:P38968	0.490	0.472	5.051E-49	1273	0.248	0.238	P38968.pdb.gz	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
10	AFDB:Q385F2	0.420	0.416	1.895E-42	1231	0.232	0.230	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
11	PDB:4bzjC	0.471	0.798	1.328E-35	693	0.157	0.276	4bzjC.pdb.gz
12	PDB:6nd4U	0.218	0.614	9.921E-15	407	0.052	0.157	6nd4U.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
13	PDB:2ybaB	0.227	0.684	1.242E-14	382	0.051	0.162	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
14	PDB:5c9zB	0.227	0.819	1.242E-14	313	0.044	0.173	5c9zB.pdb.gz	Crystal structure of PRMT5/MEP50 complex with sinefungin and 15866
15	PDB:6s29C	0.230	0.680	1.242E-14	394	0.055	0.170	6s29C.pdb.gz
16	PDB:3gfcA	0.231	0.780	2.036E-14	339	0.046	0.165	3gfcA.pdb.gz
17	PDB:3w15A	0.228	0.778	3.336E-14	336	0.047	0.170	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	PDB:6zrdA	0.227	0.629	3.818E-14	411	0.050	0.148	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
19	PDB:7uhyC	0.232	0.474	5.468E-14	578	0.054	0.114	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:7mq8LU	0.229	0.600	6.545E-14	445	0.050	0.137	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LEY1	0.0	634	1259	0.361	0.349	A0A0B4LEY1_DROME Secretory 31, isoform C OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
2	A0A0B4LEZ1	0.0	635	1260	0.362	0.351	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
3	A1Z7J6	0.0	638	1241	0.359	0.353	A1Z7J6_DROME Secretory 31, isoform B OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
4	A1Z7J7	0.0	638	1240	0.361	0.355	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
5	D6REX3	0.0	2508	1251	1.000	0.975	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
6	D6RHZ5	0.0	1825	877	0.717	0.998	D6RHZ5_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
7	H0YAB3	0.0	903	443	0.362	0.998	H0YAB3_HUMAN SEC31 homolog A, COPII coat complex component (Fragment) OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
8	H7BXG7	0.0	1831	969	0.743	0.935	H7BXG7_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
9	O94979	0.0	2524	1220	1.000	1.000	SC31A_HUMAN Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3
10	Q3UPL0	0.0	2239	1230	0.917	0.910	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
11	Q5U0U9	0.0	638	1240	0.362	0.356	Q5U0U9_DROME AT25839p OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=2 SV=1
12	Q7SYD5	0.0	1454	1254	0.632	0.615	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
13	Q9NQW1	0.0	1048	1179	0.486	0.503	SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens OX=9606 GN=SEC31B PE=1 SV=1
14	Q9Z2Q1	0.0	2146	1249	0.894	0.873	SC31A_RAT Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=2
15	Q8L611	5.47e-136	444	1104	0.246	0.272	SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC31B PE=1 SV=1
16	O13637	5.59e-87	310	1224	0.192	0.191	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
17	P38968	2.51e-73	270	1273	0.175	0.168	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
18	Q961K5	1.78e-59	222	777	0.188	0.295	Q961K5_DROME GH19061p OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=2 SV=1
19	O96221	6.99e-41	167	1471	0.086	0.071	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3
20	Q385F2	9.58e-33	140	1231	0.083	0.082	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08727 P3A	3.6e+02	12.0	Poliovirus 3A protein like
2	PF02840 Prp18	2e+02	13.5	Prp18 domain
3	PF12931 Sec16_C	0.039	25.2	Sec23-binding domain of Sec16
4	PF07304 SRA1	8.6e+02	11.1	Steroid receptor RNA activator (SRA1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264933	0.999	Programmed cell death protein 6
2	9606.ENSP00000306881	0.999	Protein transport protein Sec23A
3	9606.ENSP00000373312	0.999	Protein SEC13 homolog
4	9606.ENSP00000428564	0.998	Protein transport protein Sec24B
5	9606.ENSP00000338844	0.996	Protein transport protein Sec23B
6	9606.ENSP00000343405	0.996	Protein transport protein Sec24C
7	9606.ENSP00000362339	0.996	GTP-binding protein SAR1a
8	9606.ENSP00000381823	0.996	Protein transport protein Sec24A
9	9606.ENSP00000325827	0.995	Protein transport protein Sec16A
10	9606.ENSP00000280551	0.994	Protein transport protein Sec24D
11	9606.ENSP00000385432	0.986	GTP-binding protein SAR1b
12	9606.ENSP00000356230	0.983	Kelch-like protein 12
13	9606.ENSP00000362807	0.976	Peflin
14	9606.ENSP00000308339	0.973	Protein transport protein Sec16B
15	9606.ENSP00000240851	0.971	Protein TFG
16	9606.ENSP00000358071	0.957	SEC23-interacting protein
17	9606.ENSP00000251047	0.918	Protein ERGIC-53
18	9606.ENSP00000216037	0.911	X-box-binding protein 1
19	9606.ENSP00000405926	0.900	Transmembrane emp24 domain-containing protein 7
20	9606.ENSP00000294179	0.877	Syntaxin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048306	0.995	calcium-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0006996	0.988	organelle organization
GO:0048193	0.955	Golgi vesicle transport
GO:0006888	0.952	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0016050	0.941	vesicle organization
GO:0042221	0.908	response to chemical
GO:0061024	0.906	membrane organization
GO:0006900	0.878	vesicle budding from membrane
GO:0051592	0.777	response to calcium ion
GO:0065007	0.708	biological regulation
GO:0050789	0.586	regulation of biological process
GO:0048518	0.366	positive regulation of biological process
GO:0050794	0.341	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.988	endomembrane system
GO:0031090	0.940	organelle membrane
GO:0031982	0.919	vesicle
GO:0098588	0.890	bounding membrane of organelle
GO:0031410	0.809	cytoplasmic vesicle
GO:0005783	0.702	endoplasmic reticulum
GO:0031984	0.556	organelle subcompartment
GO:0032991	0.528	protein-containing complex
GO:0030134	0.504	COPII-coated ER to Golgi transport vesicle
GO:0030659	0.457	cytoplasmic vesicle membrane
GO:0030662	0.437	coated vesicle membrane
GO:0030133	0.349	transport vesicle
GO:0012507	0.319	ER to Golgi transport vesicle membrane
GO:0098796	0.316	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]