StarFunc result for job id O94983

User Input

>input (1202 residues)
MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEW
LSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMECLYGCYV
HSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLKWSREE
LLGQLKPMFHGIKWSCGNGTEEFSVEHLVQQILDTHPTKPAPRTHACLCSGGLGSGSLTH
KCSSTKHRIISPKVEPRALTLTSIPHAHPPEPPPLIAPLPPELPKAHTSPSSSSSSSSSG
FAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGGLTPTRHLAPQADPRPSMSLAVVV
GTEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVSPDFPEAEAAHTPCSALEPAAALE
PQAAARGPPPQSVAGGRRGNCFFIQDDDSGEELKGHGAAPPIPSPPPSPPPSPAPLEPSS
RVGRGEALFGGPVGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPALSTITDFSP
EWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVA
GREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRMAEIAAAGQ
VPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGSPFRGMSLLHLAAA
QGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAVLLFRWNR
QALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEPSVEPPFALSPPSSSPDTGLSSVS
SPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTMEDMAPGQLSSGVPEAPLLLMDYEA
TNSKGPLSSLPALPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFV
GLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWA
EFLSASTSGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVAAAVIQR
CYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQHYRSYRR
RPGPPHRTSATLPARNKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQELEGLPQPGL
AT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80Y50	0.417	0.415	0.000	1208	0.923	0.919	Q80Y50.pdb.gz	CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus OX=10090 GN=Camta2 PE=2 SV=1
2	AFDB:Q9VMA7	0.048	0.041	2.541E-6	1430	0.105	0.088	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
3	AFDB:E9QAP7	0.064	0.071	2.040E-5	1042	0.139	0.160	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
4	AFDB:Q8JG61	0.043	0.036	6.105E-5	1534	0.119	0.093	Q8JG61.pdb.gz	Q8JG61_DANRE Erythrocyte membrane protein band 4.1 (Elliptocytosis 1, RH-linked) OS=Danio rerio OX=7955 GN=epb41 PE=2 SV=1
5	PDB:6vxkB	0.069	0.109	1.045E-4	747	0.012	0.019	6vxkB.pdb.gz
6	PDB:4bszB	0.092	0.652	1.302E-4	150	0.021	0.167	4bszB.pdb.gz
7	AFDB:Q9W539	0.054	0.048	1.827E-4	1518	0.134	0.106	Q9W539.pdb.gz	HR4_DROME Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4
8	AFDB:Q9VC64	0.059	0.044	3.340E-4	1729	0.146	0.102	Q9VC64.pdb.gz	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
9	AFDB:P29617	0.040	0.032	4.902E-4	1703	0.141	0.099	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
10	PDB:8cs9A	0.074	0.105	6.041E-4	796	0.027	0.040	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
11	PDB:1bd8A	0.080	0.540	6.741E-4	156	0.021	0.160	1bd8A.pdb.gz
12	AFDB:Q7KUE4	0.047	0.043	7.600E-4	1149	0.111	0.116	Q7KUE4.pdb.gz	Q7KUE4_DROME Tonalli, isoform B OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=1
13	AFDB:A2A935	0.039	0.037	1.115E-3	1275	0.119	0.112	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
14	PDB:2dvwA	0.077	0.294	1.375E-3	229	0.024	0.127	2dvwA.pdb.gz
15	AFDB:Q8BI84	0.075	0.049	1.467E-3	1930	0.123	0.077	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
16	PDB:4oauC	0.087	0.142	1.620E-3	692	0.028	0.049	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:7df7B	0.076	0.594	1.620E-3	119	0.020	0.202	7df7B.pdb.gz
18	PDB:1wg0A	0.075	0.347	2.252E-3	243	0.024	0.119	1wg0A.pdb.gz
19	PDB:3ehqA	0.066	0.398	3.688E-3	182	0.022	0.148	3ehqA.pdb.gz
20	PDB:6jd6B	0.082	0.374	4.115E-3	192	0.023	0.146	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94983	0.0	2443	1202	1.000	1.000	CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens OX=9606 GN=CAMTA2 PE=1 SV=3
2	Q80Y50	0.0	2042	1208	0.925	0.921	CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus OX=10090 GN=Camta2 PE=2 SV=1
3	A2A891	3.43e-134	450	1682	0.168	0.120	CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus OX=10090 GN=Camta1 PE=2 SV=1
4	Q9Y6Y1	8.86e-134	449	1673	0.167	0.120	CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens OX=9606 GN=CAMTA1 PE=1 SV=4
5	A0SQK5	4.71e-85	307	2009	0.211	0.126	A0SQK5_DROME Calmodulin-binding transcription activator OS=Drosophila melanogaster OX=7227 GN=Camta PE=2 SV=1
6	E1JH18	5.99e-85	307	2004	0.210	0.126	E1JH18_DROME Calmodulin-binding transcription activator, isoform G OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
7	B7YZU5	7.50e-85	306	2005	0.210	0.126	B7YZU5_DROME Calmodulin-binding transcription activator, isoform B OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
8	B7YZS4	1.25e-84	306	1842	0.214	0.140	B7YZS4_DROME Calmodulin-binding transcription activator, isoform E OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
9	A0A0B4LF15	2.82e-84	305	1988	0.210	0.127	A0A0B4LF15_DROME Calmodulin-binding transcription activator, isoform I OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
10	B7YZU4	1.59e-83	303	2044	0.215	0.127	B7YZU4_DROME Calmodulin-binding transcription activator, isoform F OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
11	A1Z7V0	2.16e-83	302	1881	0.215	0.138	A1Z7V0_DROME Calmodulin-binding transcription activator, isoform D OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=3
12	A0A0B4LF06	4.58e-83	301	1675	0.215	0.155	A0A0B4LF06_DROME Calmodulin-binding transcription activator, isoform H OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
13	Q95RQ6	4.72e-27	118	459	0.089	0.233	Q95RQ6_DROME LD15680p OS=Drosophila melanogaster OX=7227 GN=Camta PE=2 SV=1
14	H2KY84	1.28e-23	110	1185	0.146	0.148	CMTA1_CAEEL Calmodulin-binding transcription activator homolog 1 OS=Caenorhabditis elegans OX=6239 GN=camt-1 PE=1 SV=1
15	Q9FY74	3.81e-20	99.4	1007	0.043	0.052	CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana OX=3702 GN=CAMTA1 PE=1 SV=2
16	Q6NPP4	1.11e-19	98.2	1050	0.042	0.049	CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana OX=3702 GN=CAMTA2 PE=1 SV=1
17	Q8GSA7	9.28e-19	95.1	1032	0.041	0.047	CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana OX=3702 GN=CAMTA3 PE=1 SV=1
18	F4KCL4	3.23e-17	90.1	1066	0.037	0.042	F4KCL4_ARATH Ethylene induced calmodulin binding protein OS=Arabidopsis thaliana OX=3702 GN=EICBPB PE=1 SV=1
19	Q7XHR2	3.88e-17	89.7	927	0.038	0.050	CBT_ORYSJ Calmodulin-binding transcription activator CBT OS=Oryza sativa subsp. japonica OX=39947 GN=CBT PE=1 SV=1
20	Q9LSP8	2.36e-15	83.6	838	0.033	0.048	CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana OX=3702 GN=CAMTA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19188 AGRB_N	32	16.1	Adhesion GPCR B N-terminal region
2	PF00023 Ank	88	15.0	Ankyrin repeat
3	PF12796 Ank_2	0.066	25.1	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	10	17.9	Ankyrin repeat
5	PF13637 Ank_4	66	15.5	Ankyrin repeats (many copies)
6	PF13857 Ank_5	0.016	26.8	Ankyrin repeats (many copies)
7	PF03859 CG-1	1.5e-37	139.3	CG-1 domain
8	PF08335 GlnD_UR_UTase	1.1e+02	14.2	GlnD PII-uridylyltransferase
9	PF00612 IQ	0.45	21.4	IQ calmodulin-binding motif
10	PF16614 RhoGEF67_u2	2.6e+02	13.3	Unstructured region two on RhoGEF 6 and 7
11	PF15894 SgrT	2.6e+02	13.0	Inhibitor of glucose uptake transporter SgrT
12	PF01833 TIG	2.8e-07	41.9	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000008985

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000013915	0.887	enoyl-CoA delta isomerase 1
2	9593.ENSGGOP00000003864	0.791	Family with sequence similarity 192, member A
3	9593.ENSGGOP00000006946	0.766	RCSD domain containing 1
4	9593.ENSGGOP00000014031	0.747	Membrane bound O-acyltransferase domain containing 1
5	9593.ENSGGOP00000001344	0.707	Coiled-coil domain containing 174
6	9593.ENSGGOP00000007683	0.699	Prolyl 4-hydroxylase, alpha polypeptide III
7	9593.ENSGGOP00000005265	0.665	Protein phosphatase 1, regulatory subunit 35
8	9593.ENSGGOP00000022552	0.663	Zinc finger protein 628
9	9593.ENSGGOP00000018195	0.655	Belongs to the protein kinase superfamily.
10	9593.ENSGGOP00000014473	0.647	Beta-microseminoprotein
11	9593.ENSGGOP00000023253	0.647	Coiled-coil domain containing 80
12	9593.ENSGGOP00000001988	0.644	Death-associated protein kinase 3
13	9593.ENSGGOP00000009903	0.626	Uncharacterized protein
14	9593.ENSGGOP00000014189	0.569	Tumor necrosis factor (ligand) superfamily, member 10
15	9593.ENSGGOP00000003334	0.566	Membrane bound O-acyltransferase domain containing 4
16	9593.ENSGGOP00000007706	0.531	Phospholipase D1, phosphatidylcholine-specific
17	9593.ENSGGOP00000000663	0.527	Sterile alpha motif domain containing 4A
18	9593.ENSGGOP00000019161	0.527	Uncharacterized protein
19	9593.ENSGGOP00000022118	0.527	Uncharacterized protein
20	9593.ENSGGOP00000005240	0.525	Diablo, IAP-binding mitochondrial protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.999	sequence-specific DNA binding
GO:0005515	0.995	protein binding
GO:0140110	0.827	transcription regulator activity
GO:0019899	0.815	enzyme binding
GO:0042826	0.749	histone deacetylase binding
GO:0003682	0.670	chromatin binding
GO:0003712	0.618	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031325	0.987	positive regulation of cellular metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0045893	0.973	positive regulation of DNA-templated transcription
GO:0045944	0.870	positive regulation of transcription by RNA polymerase II
GO:0050896	0.586	response to stimulus
GO:0032501	0.319	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005694	0.744	chromosome
GO:0000785	0.703	chromatin
GO:0005737	0.455	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]