StarFunc result for job id O94985

User Input

>input (981 residues)
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLI
ALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCEL
QKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYD
SILRVEAVDADCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAY
DCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQ
ATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSD
QVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL
YVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHE
PFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLA
GLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDK
AMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGV
HHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTC
EVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNW
HARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFV
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENE
MDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQ
GDPQNATRQQQLEWDDSTLSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0S5G3	0.600	0.626	0.000	937	0.513	0.537	B0S5G3.pdb.gz	CSTN2_DANRE calsyntenin-2 OS=Danio rerio OX=7955 GN=clstn2a PE=1 SV=1
2	AFDB:E7EYL3	0.765	0.772	0.000	971	0.744	0.752	E7EYL3.pdb.gz
3	AFDB:E9QCL6	0.702	0.710	0.000	969	0.486	0.492	E9QCL6.pdb.gz
4	AFDB:O94985	1.000	1.000	0.000	981	1.000	1.000	O94985.pdb.gz	CSTN1_HUMAN Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE=1 SV=1
5	AFDB:Q8R553	0.718	0.734	0.000	957	0.498	0.511	Q8R553.pdb.gz	CSTN3_RAT Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Clstn3 PE=2 SV=1
6	AFDB:Q9ER65	0.578	0.587	0.000	966	0.528	0.536	Q9ER65.pdb.gz	CSTN2_MOUSE Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2
7	AFDB:Q7ZTX9	0.249	0.743	8.125E-45	317	0.232	0.719	Q7ZTX9.pdb.gz
8	AFDB:Q14BM8	0.204	0.246	1.625E-23	802	0.126	0.155	Q14BM8.pdb.gz	Q14BM8_MOUSE Protocadherin beta 16 OS=Mus musculus OX=10090 GN=Pcdhb16 PE=2 SV=1
9	AFDB:O95206	0.206	0.190	5.559E-23	1070	0.126	0.116	O95206.pdb.gz	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
10	AFDB:Q9Y5G0	0.199	0.210	3.518E-22	923	0.111	0.118	Q9Y5G0.pdb.gz	PCDGH_HUMAN Protocadherin gamma-B5 OS=Homo sapiens OX=9606 GN=PCDHGB5 PE=2 SV=1
11	PDB:6velC	0.152	0.577	4.474E-11	209	0.051	0.239	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:5n0cA	0.135	0.107	1.142E-6	1293	0.050	0.038	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
13	PDB:3v0aB	0.157	0.136	1.907E-6	1150	0.052	0.044	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
14	PDB:7q1yA	0.090	0.070	1.907E-6	1374	0.105	0.075	7q1yA.pdb.gz
15	PDB:1e07A	0.104	0.142	6.869E-6	642	0.057	0.087	1e07A.pdb.gz
16	PDB:7q5zA	0.099	0.077	7.610E-6	1344	0.088	0.064	7q5zA.pdb.gz
17	PDB:7zl1A	0.120	0.466	1.147E-5	215	0.032	0.144	7zl1A.pdb.gz
18	PDB:7vonA	0.082	0.062	1.408E-5	1399	0.082	0.057	7vonA.pdb.gz
19	PDB:3ffzA	0.128	0.105	2.350E-5	1246	0.036	0.028	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:7ufgB	0.146	0.123	2.885E-5	1182	0.034	0.028	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S5G3	0.0	1032	937	0.490	0.513	CSTN2_DANRE calsyntenin-2 OS=Danio rerio OX=7955 GN=clstn2a PE=1 SV=1
2	F1R520	0.0	1493	954	0.741	0.762	CSTN1_DANRE calsyntenin-1 OS=Danio rerio OX=7955 GN=clstn1 PE=1 SV=1
3	O94985	0.0	2041	981	1.000	1.000	CSTN1_HUMAN Calsyntenin-1 OS=Homo sapiens OX=9606 GN=CLSTN1 PE=1 SV=1
4	Q6Q0N0	0.0	1721	952	0.902	0.930	CSTN1_RAT Calsyntenin-1 OS=Rattus norvegicus OX=10116 GN=Clstn1 PE=1 SV=1
5	Q8R553	0.0	1021	957	0.504	0.516	CSTN3_RAT Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Clstn3 PE=2 SV=1
6	Q8VDA1	0.0	1066	965	0.505	0.513	CSTN2_RAT Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Clstn2 PE=2 SV=1
7	Q99JH7	0.0	1031	956	0.508	0.521	CSTN3_MOUSE Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 PE=1 SV=1
8	Q9BQT9	0.0	996	956	0.498	0.512	CSTN3_HUMAN Calsyntenin-3 OS=Homo sapiens OX=9606 GN=CLSTN3 PE=1 SV=1
9	Q9EPL2	0.0	1783	979	0.925	0.926	CSTN1_MOUSE Calsyntenin-1 OS=Mus musculus OX=10090 GN=Clstn1 PE=1 SV=1
10	Q9ER65	0.0	1070	966	0.506	0.513	CSTN2_MOUSE Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2
11	G5ED46	1.50e-100	340	984	0.231	0.231	CASY1_CAEEL Calsyntenin-1 OS=Caenorhabditis elegans OX=6239 GN=casy-1 PE=1 SV=1
12	Q9BZA7	3.42e-10	66.6	1347	0.076	0.056	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
13	Q9V5N8	7.26e-10	65.9	3579	0.071	0.020	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
14	Q9NYQ7	1.35e-09	65.1	3312	0.044	0.013	CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens OX=9606 GN=CELSR3 PE=1 SV=2
15	Q8BNA6	1.69e-09	64.7	4555	0.051	0.011	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
16	Q91ZI0	2.37e-09	64.3	3301	0.044	0.013	CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus OX=10090 GN=Celsr3 PE=2 SV=2
17	Q9VAF5	3.22e-09	63.5	1706	0.069	0.040	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
18	F1QA09	4.61e-09	63.2	4546	0.054	0.012	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
19	A0A2R8QAL3	4.74e-09	63.2	4601	0.054	0.012	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
20	X1WCY4	4.86e-09	63.2	4578	0.054	0.012	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	6.8e-13	60.2	Cadherin domain
2	PF02724 CDC45	0.46	20.4	CDC45-like protein
3	PF19699 CLSTN_C	7.3e-195	658.3	Calsyntenin C-terminal
4	PF14575 EphA2_TM	25	17.0	Ephrin type-A receptor 2 transmembrane domain
5	PF14851 FAM176	8.5e+02	11.1	FAM176 family
6	PF02210 Laminin_G_2	11	18.1	Laminin G domain
7	PF13385 Laminin_G_3	0.00032	32.3	Concanavalin A-like lectin/glucanases superfamily
8	PF13965 SID-1_RNA_chan	3.4e+02	11.1	dsRNA-gated channel SID-1
9	PF01496 V_ATPase_I	1.5e+02	11.7	V-type ATPase 116kDa subunit family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414982	0.987	Kinesin light chain 1
2	9606.ENSP00000399403	0.969	Kinesin light chain 2
3	9606.ENSP00000453293	0.953	Amyloid-beta A4 precursor protein-binding family A member 2
4	9606.ENSP00000439065	0.872	Uncharacterized protein
5	9606.ENSP00000284981	0.820	Amyloid-beta A4 protein
6	9606.ENSP00000363023	0.712	Disks large-associated protein 4
7	9606.ENSP00000477213	0.703	Amyloid-beta A4 precursor protein-binding family B member 1
8	9606.ENSP00000265071	0.667	Cadherin-6
9	9606.ENSP00000027335	0.661	Cadherin-17
10	9606.ENSP00000344503	0.652	Transmembrane protein 201
11	9606.ENSP00000361824	0.616	Spectrin alpha chain, non-erythrocytic 1
12	9606.ENSP00000366430	0.606	Protein LZIC
13	9606.ENSP00000265720	0.600	tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like
14	9606.ENSP00000366474	0.586	Beta-catenin-interacting protein 1
15	9606.ENSP00000312506	0.579	Chondroitin sulfate proteoglycan 4
16	9606.ENSP00000368752	0.574	Major prion protein
17	9606.ENSP00000362824	0.548	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
18	9606.ENSP00000241014	0.541	C-Jun-amino-terminal kinase-interacting protein 1
19	9606.ENSP00000261205	0.540	Synaptotagmin-1
20	9606.ENSP00000257836	0.521	Transmembrane gamma-carboxyglutamic acid protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.976	cytoskeletal protein binding
GO:0001540	0.976	amyloid-beta binding
GO:0019894	0.970	kinesin binding
GO:0042988	0.554	X11-like protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.987	biological regulation
GO:0050794	0.977	regulation of cellular process
GO:0007155	0.944	cell adhesion
GO:0050793	0.912	regulation of developmental process
GO:0051179	0.852	localization
GO:0065008	0.844	regulation of biological quality
GO:0051128	0.829	regulation of cellular component organization
GO:0006810	0.824	transport
GO:0051641	0.754	cellular localization
GO:0048518	0.559	positive regulation of biological process
GO:0032501	0.523	multicellular organismal process
GO:0048522	0.469	positive regulation of cellular process
GO:0032502	0.452	developmental process
GO:0048856	0.431	anatomical structure development
GO:0016043	0.409	cellular component organization
GO:0098609	0.367	cell-cell adhesion
GO:0048731	0.349	system development
GO:0098742	0.320	cell-cell adhesion via plasma-membrane adhesion molecules

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.995	cytoplasm
GO:0045211	0.993	postsynaptic membrane
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0014069	0.969	postsynaptic density
GO:0098978	0.963	glutamatergic synapse
GO:0031982	0.929	vesicle
GO:0032991	0.889	protein-containing complex
GO:0005576	0.866	extracellular region
GO:0031090	0.828	organelle membrane
GO:0031410	0.778	cytoplasmic vesicle
GO:0009986	0.657	cell surface
GO:0005615	0.595	extracellular space
GO:0005768	0.420	endosome
GO:0005634	0.394	nucleus
GO:0043005	0.389	neuron projection
GO:0036477	0.366	somatodendritic compartment
GO:0098588	0.352	bounding membrane of organelle
GO:0043233	0.350	organelle lumen
GO:0099634	0.326	postsynaptic specialization membrane
GO:0098839	0.320	postsynaptic density membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]