StarFunc result for job id O94986

User Input

>input (1710 residues)
MSLDFGSVALPVQNEDEEYDEEDYEREKELQQLLTDLPHDMLDDDLSSPELQYSDCSEDG
TDGQPHHPEQLEMSWNEQMLPKSQSVNGYNEIQSLYAGEKCGNVWEENRSKTEDRHPVYH
PEEGGDEGGSGYSPPSKCEQTDLYHLPENFRPYTNGQKQEFNNQATNVIKFSDPQWNHFQ
GPSCQGLEPYNKVTYKPYQSSAQNNGSPAQEITGSDTFEGLQQQFLGANENSAENMQIIQ
LQVLNKAKERQLENLIEKLNESERQIRYLNHQLVIIKDEKDGLTLSLRESQKLFQNGKER
EIQLEAQIKALETQIQALKVNEEQMIKKSRTTEMALESLKQQLVDLHHSESLQRAREQHE
SIVMGLTKKYEEQVLSLQKNLDATVTALKEQEDICSRLKDHVKQLERNQEAIKLEKTEII
NKLTRSLEESQKQCAHLLQSGSVQEVAQLQFQLQQAQKAHAMSANMNKALQEELTELKDE
ISLYESAAKLGIHPSDSEGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKD
EFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTS
EKPKNQLWPESSTSDVVRDDILLLKNEIQVLQQQNQELKETEGKLRNTNQDLCNQMRQMV
QDFDHDKQEAVDRCERTYQQHHEAMKTQIRESLLAKHALEKQQLFEAYERTHLQLRSELD
KLNKEVTAVQECYLEVCREKDNLELTLRKTTEKEQQTQEKIKEKLIQQLEKEWQSKLDQT
IKAMKKKTLDCGSQTDQVTTSDVISKKEMAIMIEEQKCTIQQNLEQEKDIAIKGAMKKLE
IELELKHCENITKQVEIAVQNAHQRWLGELPELAEYQALVKAEQKKWEEQHEVSVNKRIS
FAVSEAKEKWKSELENMRKNILPGKELEEKIHSLQKELELKNEEVPVVIRAELAKARSEW
NKEKQEEIHRIQEQNEQDYRQFLDDHRNKINEVLAAAKEDFMKQKTELLLQKETELQTCL
DQSRREWTMQEAKRIQLEIYQYEEDILTVLGVLLSDTQKEHISDSEDKQLLEIMSTCSSK
WMSVQYFEKLKGCIQKAFQDTLPLLVENADPEWKKRNMAELSKDSASQGTGQGDPGPAAG
HHAQPLALQATEAEADKKKVLEIKDLCCGHCFQELEKAKQECQDLKGKLEKCCRHLQHLE
RKHKAVVEKIGEENNKVVEELIEENNDMKNKLEELQTLCKTPPRSLSAGAIENACLPCSG
GALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRKYYLICLQ
QILQDDGKEGAEKKIMNAASKLATMAKLLETPISSKSQSKTTQSALPLTSEMLIAVKKSK
RNDVNQKIPCCIESKSNSVNTITRTLCEQAPKRRAACNLQRLLENSEHQSIKHVGSKETH
LEFQFGDGSCKHLNSLPRNVSPEFVPCEGEGGFGLHKKKDLLSDNGSESLPHSAAYPFLG
TLGNKPSPRCTPGPSESGCMHITFRDSNERLGLKVYKCNPLMESENAASEKSQGLDVQEP
PVKDGGDLSDCLGWPSSSATLSFDSREASFVHGRPQGTLEIPSESVKSKQFSPSGYLSDT
EESNMICQTMKCQRYQTPYLSEETTYLEPGKISVNCGHPSRHKADRLKSDFKKLSSTLPS
SVCQQPSRKLIVPLSSQQDSGFDSPFVNLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AUM9	0.134	0.132	0.000	1736	0.651	0.642	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
2	AFDB:O94986	1.000	1.000	0.000	1710	1.000	1.000	O94986.pdb.gz	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
3	AFDB:Q5EE04	0.080	0.071	3.805E-10	1997	0.146	0.125	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
4	AFDB:E9Q7G0	0.068	0.057	4.662E-10	2094	0.153	0.125	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
5	AFDB:Q8IR55	0.058	0.040	6.111E-10	2567	0.163	0.108	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
6	AFDB:F6ZDS4	0.079	0.059	6.538E-10	2431	0.142	0.100	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
7	AFDB:A1Z8P9	0.072	0.055	5.700E-9	2346	0.137	0.100	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
8	AFDB:Q14980	0.054	0.047	9.776E-8	2115	0.159	0.129	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
9	AFDB:Q585C9	0.062	0.079	2.058E-7	1271	0.109	0.147	Q585C9.pdb.gz	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1
10	AFDB:Q4L180	0.070	0.097	2.886E-7	1135	0.111	0.167	Q4L180.pdb.gz	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
11	PDB:7qsdd	0.024	0.257	2.910	120	0.009	0.133	7qsdd.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
12	PDB:5xtcg	0.025	0.239	4.368	119	0.007	0.101	5xtcg.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
13	PDB:6hivAg	0.029	0.143	5.001	259	0.009	0.062	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:8escS	0.030	0.102	6.555	268	0.012	0.078	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
15	PDB:7k0mA	0.018	0.054	7.505	464	0.006	0.024	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
16	PDB:2v6l0	0.020	0.305	8.031	82	0.007	0.146	2v6l0.pdb.gz
17	PDB:3c98B	0.023	0.113	8.593	230	0.007	0.052	3c98B.pdb.gz
18	PDB:4wlwA	0.027	0.153	8.593	130	0.009	0.123	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
19	PDB:7qooK	0.035	0.186	8.593	253	0.020	0.138	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:3wqyA	0.019	0.035	9.838	905	0.011	0.020	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AUM9	0.0	2059	1736	0.655	0.645	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
2	O94986	0.0	3508	1710	1.000	1.000	CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens OX=9606 GN=CEP152 PE=1 SV=4
3	Q498G2	0.0	1019	1663	0.423	0.435	CE152_XENLA Centrosomal protein of 152 kDa OS=Xenopus laevis OX=8355 GN=cep152 PE=2 SV=1
4	B9EKI3	0.59	37.4	1091	0.031	0.049	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
5	P82094	0.68	37.4	1093	0.028	0.044	TMF1_HUMAN TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2
6	Q8C9S4	1.4	36.2	917	0.019	0.035	CC186_MOUSE Coiled-coil domain-containing protein 186 OS=Mus musculus OX=10090 GN=Ccdc186 PE=1 SV=2
7	P05661	3.8	35.0	1962	0.027	0.023	MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4
8	Q6ZQ06	4.8	34.7	1403	0.060	0.073	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
9	F4JGP4	6.4	33.9	790	0.037	0.081	KN14D_ARATH Kinesin-like protein KIN-14D OS=Arabidopsis thaliana OX=3702 GN=KIN14D PE=2 SV=1
10	Q96N16	7.0	33.9	626	0.012	0.034	JKIP1_HUMAN Janus kinase and microtubule-interacting protein 1 OS=Homo sapiens OX=9606 GN=JAKMIP1 PE=1 SV=1
11	Q38G07	8.7	33.5	813	0.010	0.021	Q38G07_TRYB2 BRCT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0340 PE=4 SV=1
12	Q8BVL9	9.3	33.5	626	0.012	0.034	JKIP1_MOUSE Janus kinase and microtubule-interacting protein 1 OS=Mus musculus OX=10090 GN=Jakmip1 PE=1 SV=2
13	Q3SWS9	9.4	33.5	626	0.012	0.034	JKIP1_RAT Janus kinase and microtubule-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Jakmip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13602 ADH_zinc_N_2	4.1e+02	13.4	Zinc-binding dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370337

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270861	0.999	Serine/threonine-protein kinase PLK4
2	9606.ENSP00000371308	0.999	Centromere protein J
3	9606.ENSP00000336524	0.998	Centrosomal protein of 63 kDa
4	9606.ENSP00000343818	0.995	CDK5 regulatory subunit-associated protein 2
5	9606.ENSP00000257287	0.983	Centrosomal protein of 135 kDa
6	9606.ENSP00000352572	0.972	Pericentrin
7	9606.ENSP00000360944	0.957	SCL-interrupting locus protein
8	9606.ENSP00000287482	0.956	Spindle assembly abnormal protein 6 homolog
9	9606.ENSP00000384792	0.940	WD repeat-containing protein 62
10	9606.ENSP00000427550	0.932	Centrosomal protein of 192 kDa
11	9606.ENSP00000298050	0.910	Deuterosome assembly protein 1
12	9606.ENSP00000356379	0.909	Abnormal spindle-like microcephaly-associated protein
13	9606.ENSP00000370803	0.886	Centriolar coiled-coil protein of 110 kDa
14	9606.ENSP00000348573	0.883	A-kinase anchor protein 9
15	9606.ENSP00000316681	0.860	Centrosomal protein of 295 kDa
16	9606.ENSP00000300093	0.834	Serine/threonine-protein kinase PLK1
17	9606.ENSP00000335463	0.811	Kinetochore scaffold 1
18	9606.ENSP00000317902	0.797	Centrosomal protein of 57 kDa
19	9606.ENSP00000451211	0.793	Protein NEDD1
20	9606.ENSP00000342924	0.776	Microcephalin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0007098	0.991	centrosome cycle
GO:0051298	0.961	centrosome duplication
GO:0007099	0.949	centriole replication
GO:0050794	0.627	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0032991	0.998	protein-containing complex
GO:0005829	0.998	cytosol
GO:0005654	0.997	nucleoplasm
GO:0005814	0.960	centriole
GO:0000242	0.491	pericentriolar material
GO:0120098	0.402	procentriole
GO:0120099	0.402	procentriole replication complex
GO:0012505	0.337	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]