StarFunc result for job id O94988

User Input

>input (1023 residues)
MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPA
VVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLF
LRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAK
HHVQNRMNVHNLATVFGPNCFHVPPGLEGMKEQDLCNKIMAKILENYNTLFEVEYTENDH
LRCENLARLIIVKEVYYKNSLPILLTRGLERDMPKPPPKTKIPKSRSEGSIQAHRVLQPE
LSDGIPQLSLRLSYRKACLEDMNSAEGAISAKLVPSSQEDERPLSPFYLSAHVPQVSNVS
ATGELLERTIRSAVEQHLFDVNNSGGQSSEDSESGTLSASSATSARQRRRQSKEQDEVRH
GRDKGLINKENTPSGFNHLDDCILNTQEVEKVHKNTFGCAGERSKPKRQKSSTKLSELHD
NQDGLVNMESLNSTRSHERTGPDDFEWMSDERKGNEKDGGHTQHFESPTMKIQEHPSLSD
TKQQRNQDAGDQEESFVSEVPQSDLTALCDEKNWEEPIPAFSSWQRENSDSDEAHLSPQA
GRLIRQLLDEDSDPMLSPRFYAYGQSRQYLDDTEVPPSPPNSHSFMRRRSSSLGSYDDEQ
EDLTPAQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLK
ESKLKISEEDLTPRMRQRSNTLPKSFGSQLEKEDEKKQELVDKAIKPSVEATLESIQRKL
QEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRL
VKQILSRANTIPIIGSPSSKRRSPLLQPIIEGETASFFKEIKEEEEGSEDDSNVKPDFMV
TLKTDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMRE
EKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDS
KSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94988	1.000	1.000	0.000	1023	1.000	1.000	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
2	AFDB:Q8N264	0.202	0.271	3.059E-13	748	0.143	0.195	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
3	PDB:6r3vA	0.185	0.925	2.685E-12	198	0.064	0.328	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
4	AFDB:Q9VIS1	0.215	0.123	9.290E-12	1843	0.176	0.098	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
5	AFDB:Q7Z6I6	0.189	0.176	1.494E-11	1101	0.147	0.136	Q7Z6I6.pdb.gz	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
6	AFDB:Q5T5U3	0.189	0.101	1.560E-11	1958	0.152	0.079	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
7	PDB:3cxlA	0.192	0.469	1.493E-10	402	0.060	0.152	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
8	AFDB:Q9VDS5	0.184	0.251	1.754E-10	740	0.095	0.131	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
9	AFDB:X2JDY8	0.172	0.171	2.374E-10	1025	0.099	0.099	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
10	AFDB:Q68EM7	0.189	0.218	4.739E-10	881	0.119	0.138	Q68EM7.pdb.gz	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
11	AFDB:Q99N37	0.188	0.223	5.166E-10	858	0.111	0.133	Q99N37.pdb.gz	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
12	PDB:1xa6A	0.194	0.481	1.352E-9	399	0.057	0.145	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	AFDB:Q7Z6B7	0.187	0.177	4.292E-9	1085	0.119	0.112	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
14	PDB:5c2kA	0.171	0.440	3.608E-8	382	0.058	0.154	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:5jcpA	0.171	0.464	3.608E-8	361	0.052	0.147	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:6awlA	0.055	0.147	8.188E-1	217	0.026	0.124	6awlA.pdb.gz
17	PDB:3euhB	0.064	0.159	1.208	321	0.031	0.100	3euhB.pdb.gz
18	PDB:7d5sB2	0.048	0.053	1.499	851	0.028	0.034	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:4gouA	0.047	0.077	1.707	507	0.037	0.075	4gouA.pdb.gz
20	PDB:3pjaL	0.079	0.207	2.118	223	0.037	0.170	3pjaL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94988	0.0	2112	1023	1.000	1.000	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
2	Q9NYF5	6.67e-145	457	915	0.304	0.340	FA13B_HUMAN Protein FAM13B OS=Homo sapiens OX=9606 GN=FAM13B PE=1 SV=2
3	Q8NE31	1.79e-71	251	585	0.175	0.306	FA13C_HUMAN Protein FAM13C OS=Homo sapiens OX=9606 GN=FAM13C PE=1 SV=2
4	A0A8I6A7T6	5.13e-30	126	410	0.068	0.171	A0A8I6A7T6_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
5	D4A6C5	1.21e-29	125	439	0.068	0.159	D4A6C5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
6	A0A0G2JYR5	4.79e-29	125	512	0.068	0.137	A0A0G2JYR5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
7	Q07960	3.15e-27	118	439	0.064	0.148	RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1
8	Q5FWK3	1.08e-26	116	439	0.066	0.155	RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arhgap1 PE=1 SV=1
9	Q8N264	5.64e-24	110	748	0.063	0.086	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
10	Q7Z5H3	2.28e-23	108	698	0.065	0.095	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
11	Q8C4V1	3.88e-23	108	747	0.063	0.086	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
12	P85298	1.46e-22	104	464	0.064	0.140	RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8 PE=1 SV=1
13	B1AHC3	1.94e-22	105	564	0.064	0.115	B1AHC3_HUMAN PRR5-ARHGAP8 readthrough OS=Homo sapiens OX=9606 GN=PRR5-ARHGAP8 PE=1 SV=1
14	Q9W4A9	3.26e-21	100	494	0.057	0.117	Q9W4A9_DROME Rho GTPase activating protein at 5A, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP5A PE=4 SV=1
15	Q8IZM6	3.36e-21	100	433	0.063	0.148	Q8IZM6_HUMAN BCH domain-containing Cdc42GAP-like protein OS=Homo sapiens OX=9606 GN=BPGAP1 PE=2 SV=1
16	P42331	1.01e-20	100	645	0.062	0.098	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
17	Q58AA5	2.34e-20	93.6	245	0.061	0.253	Q58AA5_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-1 PE=1 SV=1
18	B4DN07	4.17e-20	98.2	604	0.069	0.118	B4DN07_HUMAN Rho GTPase activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
19	O43182	4.46e-20	99.0	974	0.069	0.073	RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=3
20	O54834	5.87e-20	98.6	987	0.070	0.073	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12361 DBP	8.5e+02	11.0	Duffy-antigen binding protein
2	PF00620 RhoGAP	3.3e-39	145.6	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296575	0.769	Hedgehog-interacting protein
2	9606.ENSP00000315602	0.739	Neuronal acetylcholine receptor subunit alpha-3
3	9606.ENSP00000422354	0.714	Glutathione S-transferase C-terminal domain containing
4	9606.ENSP00000261461	0.694	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
5	9606.ENSP00000347484	0.687	Thrombospondin type-1 domain-containing protein 4
6	9606.ENSP00000258886	0.685	Iron-responsive element-binding protein 2
7	9606.ENSP00000212015	0.679	NAD-dependent protein deacetylase sirtuin-1
8	9606.ENSP00000299565	0.659	Neuronal acetylcholine receptor subunit alpha-5
9	9606.ENSP00000415433	0.657	Integrator complex subunit 12
10	9606.ENSP00000375907	0.653	PTB-containing, cubilin and LRP1-interacting protein
11	9606.ENSP00000320488	0.641	Nucleosome assembly protein 1 like 5
12	9606.ENSP00000425864	0.638	BLOC-1-related complex subunit 8
13	9606.ENSP00000406191	0.630	Transient receptor potential cation channel subfamily V member 4
14	9606.ENSP00000409964	0.623	Cilia and flagella associated protein 97
15	9606.ENSP00000352927	0.618	Microtubule cross-linking factor 1
16	9606.ENSP00000385684	0.611	Probable E3 ubiquitin-protein ligase HERC3
17	9606.ENSP00000216487	0.609	Ras and Rab interactor 3
18	9606.ENSP00000269391	0.605	E3 ubiquitin ligase RNF157
19	9606.ENSP00000433427	0.605	ADP-ribosylation factor-like protein 15
20	9606.ENSP00000332488	0.602	Signal peptide peptidase-like 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.961	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051056	0.969	regulation of small GTPase mediated signal transduction
GO:0009987	0.504	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.436	organelle
GO:0043227	0.432	membrane-bounded organelle
GO:0043229	0.397	intracellular organelle
GO:0043231	0.365	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]