StarFunc result for job id O94989

User Input

>input (841 residues)
MSAQSLPAATPPTQKPPRIIRPRPPSRSRAAQSPGPPHNGSSPQELPRNSNDAPTPMCTP
IFWEPPAASLKPPALLPPSASRASLDSQTSPDSPSSTPTPSPVSRRSASPEPAPRSPVPP
PKPSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPGLQARAD
VNGEREAPLTGSGSQENGAPDAGLACPPCCPCVCHTTRPGLELRWVPVGGYEEVPRVPRR
ASPLRTSRSRPHPPSIGHPAVVLTSYRSTAERKLLPLLKPPKPTRVRQDATIFGDPPQPD
LDLLSEDGIQTGDSPDEAPQNTPPATVEGREEEGLEVLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGSPSPANAGDAPTFPRPPGPRNTLWQELPAVQASGLLDTLSPQERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLL
SRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLEFQGELTELGCRRGGVLFASRPRFT
PLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCDCSQELCSESSAPAKTEGRSLESR
AAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQNQRLLEAVGSSSGTPNAPP
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3DTR7	0.594	0.594	0.000	841	0.996	0.996	D3DTR7.pdb.gz
2	AFDB:A0A0G2JTU0	0.596	0.590	5.514E-96	850	0.861	0.852	A0A0G2JTU0.pdb.gz	A0A0G2JTU0_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
3	AFDB:E7EY47	0.433	0.383	5.083E-36	958	0.283	0.248	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
4	AFDB:Q12774	0.434	0.234	5.586E-36	1597	0.302	0.159	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
5	AFDB:Q5I1Y9	0.363	0.534	4.911E-35	533	0.214	0.338	Q5I1Y9.pdb.gz	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:Q9Y7U6	0.326	0.214	9.755E-22	1334	0.196	0.124	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
7	AFDB:Q9TW28	0.326	0.166	1.787E-18	1737	0.155	0.075	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
8	AFDB:Q8IQ97	0.334	0.220	7.127E-17	1311	0.178	0.114	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
9	AFDB:Q6ZNL6	0.217	0.130	1.119E-14	1462	0.149	0.085	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
10	PDB:4mt6A	0.265	0.490	2.241E-14	389	0.070	0.152	4mt6A.pdb.gz
11	PDB:7rx9A	0.202	0.383	3.429E-14	432	0.083	0.162	7rx9A.pdb.gz
12	AFDB:Q96PE2	0.310	0.137	8.534E-14	2063	0.156	0.063	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
13	PDB:4gouA	0.194	0.310	1.098E-7	507	0.037	0.061	4gouA.pdb.gz
14	PDB:6bbpA	0.116	0.161	2.935E-4	520	0.046	0.075	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:6u3eA	0.108	0.198	1.212E-3	397	0.062	0.131	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:1k5dB	0.104	0.455	1.534E-3	146	0.015	0.089	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
17	PDB:3m1iB	0.104	0.482	6.040E-3	131	0.011	0.069	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
18	PDB:2kr0A	0.098	0.183	8.815E-3	407	0.038	0.079	2kr0A.pdb.gz
19	PDB:5yqrA	0.110	0.297	1.791E-2	268	0.032	0.101	5yqrA.pdb.gz
20	PDB:1lw3A	0.096	0.149	4.395E-2	513	0.015	0.025	1lw3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTU0	0.0	1197	850	0.862	0.853	A0A0G2JTU0_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
2	D3ZPJ8	0.0	810	670	0.612	0.769	D3ZPJ8_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
3	O94989	0.0	1676	841	1.000	1.000	ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens OX=9606 GN=ARHGEF15 PE=1 SV=4
4	Q5FWH6	0.0	1216	849	0.854	0.846	ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus OX=10090 GN=Arhgef15 PE=1 SV=1
5	Q5BKC9	1.18e-90	303	701	0.201	0.241	NGEF_RAT Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE=1 SV=2
6	Q8CHT1	7.60e-89	298	710	0.200	0.237	NGEF_MOUSE Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV=1
7	Q8N5V2	1.04e-86	292	710	0.197	0.234	NGEF_HUMAN Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=2
8	Q5I1Y9	3.44e-86	286	533	0.199	0.313	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
9	E9Q7D5	2.70e-80	285	1581	0.219	0.116	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
10	E7EY47	1.72e-79	278	958	0.222	0.195	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
11	A0A090N7S2	7.15e-78	263	519	0.213	0.345	A0A090N7S2_HUMAN Rho guanine nucleotide exchange factor (GEF) 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=4 SV=1
12	Q12774	2.65e-77	276	1597	0.215	0.113	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
13	Q8IW93	3.66e-73	258	802	0.201	0.211	ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens OX=9606 GN=ARHGEF19 PE=1 SV=1
14	Q5VV41	2.15e-71	251	709	0.174	0.206	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
15	Q8BWA8	1.33e-69	248	802	0.216	0.227	ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus OX=10090 GN=Arhgef19 PE=1 SV=1
16	H0Y895	1.13e-66	239	797	0.206	0.217	H0Y895_HUMAN Rho guanine nucleotide exchange factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=1
17	Q96DR7	1.02e-64	235	871	0.185	0.179	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
18	D3YYY8	1.32e-64	234	869	0.190	0.184	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
19	Q9Y150	6.93e-55	207	1051	0.201	0.161	Q9Y150_DROME BcDNA.GH03693 OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=1
20	Q9VVC6	3.77e-54	206	2029	0.201	0.083	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	4e+02	12.9	PH domain
2	PF00621 RhoGEF	1.2e-29	115.3	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281821	0.983	Ephrin type-A receptor 4
2	9606.ENSP00000400175	0.952	Transforming protein RhoA
3	9606.ENSP00000357392	0.926	Ephrin-A1
4	9606.ENSP00000232165	0.826	Ubiquitin-protein ligase E3A
5	9606.ENSP00000298694	0.783	Rho guanine nucleotide exchange factor 40
6	9606.ENSP00000363763	0.621	Ephrin type-B receptor 2
7	9606.ENSP00000442307	0.608	Epithelial cell-transforming sequence 2 oncogene-like
8	9606.ENSP00000368908	0.594	LHFPL tetraspan subfamily member 6 protein
9	9606.ENSP00000285046	0.593	FYVE, RhoGEF and PH domain-containing protein 5
10	9606.ENSP00000377197	0.582	Hydrocephalus-inducing protein homolog
11	9606.ENSP00000260952	0.581	Asparagine synthetase domain containing 1
12	9606.ENSP00000430276	0.579	Proto-oncogene DBL
13	9606.ENSP00000344961	0.577	Pleckstrin homology and RhoGEF domain containing G7
14	9606.ENSP00000433761	0.573	Membrane-spanning 4-domains subfamily A member 14
15	9606.ENSP00000240874	0.570	Kalirin
16	9606.ENSP00000280758	0.569	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
17	9606.ENSP00000259365	0.566	Tropomodulin-1
18	9606.ENSP00000263674	0.562	Rho guanine nucleotide exchange factor 17
19	9606.ENSP00000328118	0.557	Probable guanine nucleotide exchange factor MCF2L2
20	9606.ENSP00000315659	0.556	Dynamin-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	1.000	molecular function inhibitor activity
GO:0140677	1.000	molecular function activator activity
GO:0005515	1.000	protein binding
GO:0030695	1.000	GTPase regulator activity
GO:0005085	0.985	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0065009	0.955	regulation of molecular function
GO:0050790	0.943	regulation of catalytic activity
GO:0051056	0.934	regulation of small GTPase mediated signal transduction
GO:0009987	0.587	cellular process
GO:0050896	0.411	response to stimulus
GO:0048518	0.402	positive regulation of biological process
GO:0048522	0.370	positive regulation of cellular process
GO:0048519	0.314	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.977	cytosol
GO:0043226	0.647	organelle
GO:0071944	0.321	cell periphery
GO:0005886	0.307	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]