StarFunc result for job id O95025

User Input

>input (777 residues)
MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BH34	0.902	0.902	0.000	777	0.929	0.929	Q8BH34.pdb.gz	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
2	AFDB:Q90663	0.930	0.949	0.000	761	0.837	0.854	Q90663.pdb.gz	SEM3D_CHICK Semaphorin-3D OS=Gallus gallus OX=9031 GN=SEMA3D PE=2 SV=1
3	AFDB:Q9W6G6	0.856	0.871	0.000	764	0.619	0.630	Q9W6G6.pdb.gz	SEM3D_DANRE Semaphorin-3D OS=Danio rerio OX=7955 GN=sema3d PE=2 SV=1
4	AFDB:O08665	0.842	0.847	5.830E-104	772	0.528	0.531	O08665.pdb.gz	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
5	AFDB:R4GJE6	0.846	0.808	3.669E-103	815	0.514	0.490	R4GJE6.pdb.gz
6	AFDB:Q9W7J1	0.858	0.777	2.080E-101	860	0.481	0.435	Q9W7J1.pdb.gz	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1
7	AFDB:Q9W686	0.846	0.845	3.702E-101	778	0.515	0.514	Q9W686.pdb.gz	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
8	AFDB:A0A2R8Q5T8	0.848	0.833	1.629E-97	791	0.471	0.463	A0A2R8Q5T8.pdb.gz	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
9	AFDB:A0A2R8Q5P4	0.809	0.831	4.650E-97	756	0.465	0.478	A0A2R8Q5P4.pdb.gz
10	AFDB:A0A2R8QBF0	0.834	0.851	6.712E-97	761	0.474	0.484	A0A2R8QBF0.pdb.gz
11	PDB:6qp7A	0.653	0.809	3.771E-53	620	0.250	0.313	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.650	0.841	2.247E-40	588	0.212	0.281	3nvqA.pdb.gz
13	PDB:3nvnA	0.427	0.832	4.135E-21	383	0.103	0.209	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.366	0.379	5.794E-16	747	0.124	0.129	6vxkB.pdb.gz
15	PDB:7kzmD	0.225	0.336	2.748E-7	456	0.069	0.118	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
16	PDB:6nd4H	0.135	0.128	3.764E-7	834	0.102	0.095	6nd4H.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
17	PDB:2vduD	0.258	0.477	1.257E-6	376	0.045	0.093	2vduD.pdb.gz
18	PDB:6jp6A	0.177	0.146	1.722E-6	998	0.063	0.049	6jp6A.pdb.gz
19	PDB:5mzhB	0.283	0.484	2.238E-6	415	0.062	0.116	5mzhB.pdb.gz
20	PDB:7rroe	0.159	0.194	3.231E-6	610	0.076	0.097	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PZ68	706	751	0.450	0.466	A0A1D5PZ68_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=3 SV=1
2	A0A2R8Q5T8	712	791	0.467	0.459	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
3	E7F6C0	718	787	0.467	0.461	E7F6C0_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
4	F1NVZ5	852	808	0.532	0.511	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
5	M9MM97	698	771	0.440	0.444	M9MM97_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3bl OS=Danio rerio OX=7955 GN=fc22d04 PE=3 SV=1
6	O08665	862	772	0.528	0.531	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
7	O15041	715	775	0.453	0.454	SEM3E_HUMAN Semaphorin-3E OS=Homo sapiens OX=9606 GN=SEMA3E PE=1 SV=1
8	O42236	704	751	0.449	0.465	SEM3C_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=2 SV=1
9	O42237	714	785	0.441	0.437	SEM3E_CHICK Semaphorin-3E OS=Gallus gallus OX=9031 GN=SEMA3E PE=2 SV=1
10	O88632	694	785	0.436	0.432	SEM3F_MOUSE Semaphorin-3F OS=Mus musculus OX=10090 GN=Sema3f PE=2 SV=2
11	P70275	732	775	0.453	0.454	SEM3E_MOUSE Semaphorin-3E OS=Mus musculus OX=10090 GN=Sema3e PE=1 SV=3
12	Q13214	691	749	0.439	0.455	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
13	Q13275	696	785	0.439	0.434	SEM3F_HUMAN Semaphorin-3F OS=Homo sapiens OX=9606 GN=SEMA3F PE=2 SV=2
14	Q14563	860	771	0.532	0.536	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
15	Q1LYS1	655	768	0.421	0.426	Q1LYS1_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E OS=Danio rerio OX=7955 GN=fj37c11 PE=3 SV=1
16	Q4LFA9	657	780	0.447	0.445	SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 GN=Sema3g PE=2 SV=1
17	Q62181	701	751	0.443	0.458	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2
18	Q63548	862	772	0.529	0.532	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
19	Q8BH34	1524	777	0.929	0.929	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
20	Q90607	855	772	0.532	0.535	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	8.6	17.8	Immunoglobulin I-set domain
2	PF00047 ig	11	17.6	Immunoglobulin domain
3	PF13895 Ig_2	26	16.5	Immunoglobulin domain
4	PF13927 Ig_3	0.53	22.2	Immunoglobulin domain
5	PF18452 Ig_6	0.00035	31.8	Immunoglobulin domain
6	PF01437 PSI	6.2	18.8	Plexin repeat
7	PF01403 Sema	5.7e-60	213.8	Sema domain
8	PF07686 V-set	3.9	19.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.990	Neuropilin-1
2	9606.ENSP00000358696	0.921	Plexin-A3
3	9606.ENSP00000317128	0.916	Plexin-D1
4	9606.ENSP00000258526	0.886	Plexin-C1
5	9606.ENSP00000351338	0.886	Plexin-B1
6	9606.ENSP00000352882	0.886	Plexin-A4
7	9606.ENSP00000377061	0.886	Plexin-A1
8	9606.ENSP00000442736	0.886	Plexin-B3
9	9606.ENSP00000409171	0.885	Plexin-B2
10	9606.ENSP00000353582	0.759	Neuropilin-2
11	9606.ENSP00000358677	0.721	T-box transcription factor TBX18
12	9606.ENSP00000173229	0.685	Netrin-1
13	9606.ENSP00000332164	0.622	Slit homolog 3 protein
14	9606.ENSP00000478570	0.611	Vascular endothelial growth factor A
15	9606.ENSP00000275815	0.606	Ephrin type-A receptor 1
16	9606.ENSP00000356857	0.596	Transcription factor 21
17	9606.ENSP00000476384	0.586	Basic helix-loop-helix transcription factor scleraxis
18	9606.ENSP00000362299	0.577	Endoglin
19	9606.ENSP00000334319	0.574	Protein piccolo
20	9606.ENSP00000337838	0.561	Reticulon-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038191	1.000	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.990	cellular process
GO:0048731	0.989	system development
GO:0007399	0.963	nervous system development
GO:0042330	0.951	taxis
GO:0050789	0.935	regulation of biological process
GO:0030154	0.923	cell differentiation
GO:0050794	0.916	regulation of cellular process
GO:0071840	0.861	cellular component organization or biogenesis
GO:0009653	0.858	anatomical structure morphogenesis
GO:0016043	0.852	cellular component organization
GO:0048468	0.847	cell development
GO:0042221	0.836	response to chemical
GO:0051716	0.792	cellular response to stimulus
GO:0023052	0.787	signaling
GO:0007154	0.787	cell communication
GO:0006935	0.779	chemotaxis
GO:0007165	0.633	signal transduction
GO:0030182	0.621	neuron differentiation
GO:0048666	0.580	neuron development
GO:0031175	0.563	neuron projection development
GO:0048812	0.513	neuron projection morphogenesis
GO:0061564	0.490	axon development
GO:0048667	0.488	cell morphogenesis involved in neuron differentiation
GO:0007409	0.481	axonogenesis
GO:0048518	0.475	positive regulation of biological process
GO:0048522	0.469	positive regulation of cellular process
GO:0048519	0.403	negative regulation of biological process
GO:0007166	0.386	cell surface receptor signaling pathway
GO:0048523	0.320	negative regulation of cellular process
GO:0097485	0.319	neuron projection guidance
GO:0040012	0.310	regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005886	0.305	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]