StarFunc result for job id O95045

User Input

>input (317 residues)
MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVK
FVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPS
ISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDN
IVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLD
YLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR
PQLLISNFIRRRLGLCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95045	1.000	1.000	6.969E-70	317	1.000	1.000	O95045.pdb.gz	UPP2_HUMAN Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
2	AFDB:Q8CGR7	0.938	0.929	1.795E-62	320	0.877	0.869	Q8CGR7.pdb.gz	UPP2_MOUSE Uridine phosphorylase 2 OS=Mus musculus OX=10090 GN=Upp2 PE=1 SV=1
3	PDB:3p0fA	0.898	0.971	5.478E-57	293	0.924	1.000	3p0fA.pdb.gz	A novel structural mechanism for redox regulation of uridine phosphorylase 2 activity.
4	AFDB:Q499V1	0.935	0.950	5.742E-52	312	0.612	0.622	Q499V1.pdb.gz	Q499V1_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=2 SV=1
5	AFDB:Q16831	0.923	0.944	1.791E-51	310	0.612	0.626	Q16831.pdb.gz	UPP1_HUMAN Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
6	PDB:3eueA	0.905	0.972	9.372E-46	295	0.603	0.647	3eueA.pdb.gz	Implications of the structure of human uridine phosphorylase 1 on the development of novel inhibitors for improving the therapeutic window of fluoropyrimidine chemotherapy.
7	AFDB:Q9VBA0	0.902	0.778	2.872E-42	368	0.483	0.416	Q9VBA0.pdb.gz	Q9VBA0_DROME GH09623p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=2
8	AFDB:Q23588	0.879	0.943	9.607E-38	295	0.413	0.444	Q23588.pdb.gz	UTPP_CAEEL Uridine and thymidine phosphorylase OS=Caenorhabditis elegans OX=6239 GN=upp-1 PE=1 SV=2
9	PDB:4txjB	0.874	0.951	1.648E-35	291	0.388	0.423	4txjB.pdb.gz
10	AFDB:G4VGH9	0.880	0.941	9.975E-35	296	0.350	0.375	G4VGH9.pdb.gz	UPPB_SCHMA Inactive uridine phosphorylase B OS=Schistosoma mansoni OX=6183 GN=UPPB PE=1 SV=1
11	PDB:1u1cA	0.608	0.751	3.989E-17	253	0.224	0.281	1u1cA.pdb.gz	Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
12	AFDB:P12758	0.612	0.756	4.395E-16	253	0.230	0.289	P12758.pdb.gz	UDP_ECOLI Uridine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=udp PE=1 SV=3
13	PDB:1t0uA	0.523	0.729	5.409E-15	223	0.189	0.269	1t0uA.pdb.gz
14	AFDB:A5K9M4	0.599	0.757	4.979E-14	245	0.174	0.224	A5K9M4.pdb.gz	PNPH_PLAVS Purine nucleoside phosphorylase OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PNP PE=1 SV=1
15	AFDB:Q57VZ2	0.559	0.524	8.038E-14	341	0.167	0.155	Q57VZ2.pdb.gz	Q57VZ2_TRYB2 Nucleoside phosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.830 PE=1 SV=1
16	PDB:3enzC	0.555	0.693	1.146E-13	246	0.167	0.215	3enzC.pdb.gz	Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases.
17	PDB:3bjeA	0.577	0.561	2.086E-13	327	0.170	0.165	3bjeA.pdb.gz	The Crystal Structure and Activity of a Putative Trypanosomal Nucleoside Phosphorylase Reveal It to be a Homodimeric Uridine Phosphorylase
18	PDB:3emvA	0.599	0.751	3.367E-13	246	0.167	0.215	3emvA.pdb.gz
19	PDB:1a69A	0.516	0.668	9.318E-13	237	0.177	0.236	1a69A.pdb.gz	Crystal structure of the ternary complex of E. coli purine nucleoside phosphorylase with formycin B, a structural analogue of the substrate inosine, and phosphate (Sulphate) at 2.1 A resolution.
20	PDB:1nc3A	0.552	0.723	1.417E-12	235	0.142	0.191	1nc3A.pdb.gz	Structure of Escherichia coli 5'-methylthioadenosine/ S-adenosylhomocysteine nucleosidase inhibitor complexes provide insight into the conformational changes required for substrate binding and catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z6U5	0.0	561	281	0.855	0.964	A0A0S2Z6U5_HUMAN Uridine phosphorylase OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
2	O95045	0.0	654	317	1.000	1.000	UPP2_HUMAN Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
3	Q8CGR7	0.0	586	320	0.877	0.869	UPP2_MOUSE Uridine phosphorylase 2 OS=Mus musculus OX=10090 GN=Upp2 PE=1 SV=1
4	Q499V1	4.44e-146	415	312	0.612	0.622	Q499V1_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=2 SV=1
5	F7F0D5	6.28e-146	415	311	0.606	0.617	F7F0D5_RAT Uridine phosphorylase OS=Rattus norvegicus OX=10116 GN=Upp1 PE=1 SV=1
6	P52624	4.60e-143	407	311	0.593	0.605	UPP1_MOUSE Uridine phosphorylase 1 OS=Mus musculus OX=10090 GN=Upp1 PE=1 SV=2
7	Q16831	1.25e-139	399	310	0.603	0.616	UPP1_HUMAN Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
8	Q8IMQ8	2.14e-109	323	347	0.483	0.441	Q8IMQ8_DROME RH29536p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=1
9	Q9VBA0	1.34e-108	322	368	0.483	0.416	Q9VBA0_DROME GH09623p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6330 PE=1 SV=2
10	G4VGI0	8.28e-77	238	296	0.397	0.426	UPPA_SCHMA Uridine phosphorylase A OS=Schistosoma mansoni OX=6183 GN=UPPA PE=1 SV=1
11	Q23588	2.76e-76	237	295	0.416	0.447	UTPP_CAEEL Uridine and thymidine phosphorylase OS=Caenorhabditis elegans OX=6239 GN=upp-1 PE=1 SV=2
12	G4VGH9	2.01e-69	219	296	0.360	0.385	UPPB_SCHMA Inactive uridine phosphorylase B OS=Schistosoma mansoni OX=6183 GN=UPPB PE=1 SV=1
13	C9JIP2	9.45e-58	184	146	0.281	0.610	C9JIP2_HUMAN Uridine phosphorylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
14	C9J486	2.39e-56	181	144	0.274	0.604	C9J486_HUMAN Uridine phosphorylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1
15	A0A0S2Z639	4.89e-39	134	65	0.189	0.923	A0A0S2Z639_HUMAN Uridine phosphorylase 2 isoform 4 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1
16	P12758	4.09e-10	61.6	253	0.243	0.304	UDP_ECOLI Uridine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=udp PE=1 SV=3
17	Q54UM3	0.018	38.5	289	0.158	0.173	Q54UM3_DICDI Uridine phosphorylase OS=Dictyostelium discoideum OX=44689 GN=udpB PE=4 SV=1
18	Q57VZ2	0.17	35.8	341	0.221	0.205	Q57VZ2_TRYB2 Nucleoside phosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.830 PE=1 SV=1
19	P0ABP8	0.32	34.7	239	0.104	0.138	DEOD_ECOLI Purine nucleoside phosphorylase DeoD-type OS=Escherichia coli (strain K12) OX=83333 GN=deoD PE=1 SV=2
20	Q94BT6	0.72	33.9	609	0.076	0.039	ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana OX=3702 GN=ADO1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01048 PNP_UDP_1	5.5e-21	86.5	Phosphorylase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379038	0.974	Thymidine phosphorylase
2	9606.ENSP00000232607	0.971	Uridine 5'-monophosphate synthase
3	9606.ENSP00000359211	0.963	Dihydropyrimidine dehydrogenase [NADP(+)]
4	9606.ENSP00000362481	0.963	Uracil phosphoribosyltransferase homolog
5	9606.ENSP00000354532	0.954	Purine nucleoside phosphorylase
6	9606.ENSP00000361285	0.949	Uridine-cytidine kinase 1
7	9606.ENSP00000364212	0.949	Cytidine deaminase
8	9606.ENSP00000299697	0.947	Thymidine kinase 2, mitochondrial
9	9606.ENSP00000346155	0.942	Uridine-cytidine kinase-like 1
10	9606.ENSP00000301634	0.938	Thymidine kinase, cytosolic
11	9606.ENSP00000356853	0.929	Uridine-cytidine kinase 2
12	9606.ENSP00000301141	0.904	Cytochrome P450 2A6
13	9606.ENSP00000257770	0.825	5'-nucleotidase
14	9606.ENSP00000330032	0.806	Uridine phosphorylase 1
15	9606.ENSP00000286621	0.803	Adenosine kinase
16	9606.ENSP00000235628	0.793	Cytosolic 5'-nucleotidase 1A
17	9606.ENSP00000373674	0.792	5'(3')-deoxyribonucleotidase, mitochondrial
18	9606.ENSP00000245552	0.768	5'(3')-deoxyribonucleotidase, cytosolic type
19	9606.ENSP00000217426	0.760	Adenosylhomocysteinase
20	9606.ENSP00000296412	0.754	Alcohol dehydrogenase class-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004850	1.000	uridine phosphorylase activity
GO:0042802	0.988	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0009116	0.987	nucleoside metabolic process
GO:0009123	0.985	nucleoside monophosphate metabolic process
GO:0006220	0.985	pyrimidine nucleotide metabolic process
GO:0009129	0.984	pyrimidine nucleoside monophosphate metabolic process
GO:0072529	0.983	pyrimidine-containing compound catabolic process
GO:0009166	0.980	nucleotide catabolic process
GO:0042454	0.904	ribonucleoside catabolic process
GO:0009394	0.771	2'-deoxyribonucleotide metabolic process
GO:0009219	0.539	pyrimidine deoxyribonucleotide metabolic process
GO:0009162	0.538	deoxyribonucleoside monophosphate metabolic process
GO:0006213	0.342	pyrimidine nucleoside metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.949	organelle
GO:0043229	0.812	intracellular organelle
GO:0043227	0.649	membrane-bounded organelle
GO:0043231	0.483	intracellular membrane-bounded organelle
GO:0070013	0.377	intracellular organelle lumen
GO:0005634	0.318	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24388	1.000	phosphate + uridine = alpha-D-ribose 1-phosphate + uracil
EC:2.4.2.3	1.000	uridine phosphorylase.

[back to server]