StarFunc result for job id O95071

User Input

>input (1400 residues)
MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAF
LLEDGRVCRIGFSVQPDRLELGKPDNNDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETL
GRLAGNTLGSRWSSGVGGSGGGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVI
PASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDEDGDDGDDTASE
SYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGYPSFRRSSLSRLGSSRVLLLP
LERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPVQSPVSLGEDL
QWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLT
NEKIVLLSANSIRATVATENNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHCCA
LYTCAQLENSLYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNP
LYHAGAVAFSISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQ
EPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVE
DVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQVVK
TGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCIFDLATGKAEQ
ENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPP
ISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQTLMQHILRCDYEACRQYLMNLEQAVV
LEQNLQMLQTFISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVE
AIANAISVVSSNGPGNRAGSSSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPP
IAPPSWVPDPPAMDPDGDIDFILAPAVGSLTTAATGTGQGPSTSTIPGPSTEPSVVESKD
RKANAHFILKLLCDSVVLQPYLRELLSAKDARGMTPFMSAVSGRAYPAAITILETAQKIA
KAEISSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHINQDIFECRTCG
LLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLT
ATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLE
PPRFAQLALERVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRL
DCFTHCLIVKCTADILLLDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:8gqeB	0.077	0.251	1.417E-6	386	0.018	0.065	8gqeB.pdb.gz
2	PDB:5t94A	0.128	0.314	2.162E-5	454	0.040	0.123	5t94A.pdb.gz
3	PDB:6lqsBE	0.068	0.112	2.770E-5	823	0.041	0.070	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
4	PDB:5tbkI	0.071	0.212	3.378E-5	419	0.021	0.069	5tbkI.pdb.gz
5	PDB:7d4iBE	0.056	0.078	5.276E-5	890	0.039	0.061	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
6	PDB:5xgsA	0.083	0.267	7.102E-5	398	0.016	0.055	5xgsA.pdb.gz
7	PDB:7d5sBE	0.084	0.118	1.353E-4	865	0.032	0.052	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
8	PDB:7mq8LN	0.074	0.142	1.421E-4	671	0.031	0.066	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:6urgA	0.074	0.084	1.649E-4	1202	0.049	0.057	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
10	PDB:7d5sB2	0.065	0.100	1.649E-4	851	0.040	0.066	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
11	AFDB:Q9JM52	0.076	0.079	1.430E-3	1308	0.082	0.088	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
12	AFDB:O95819	0.058	0.064	3.488E-3	1239	0.071	0.081	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
13	AFDB:M9PBJ7	0.063	0.069	7.335E-3	1213	0.067	0.077	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
14	AFDB:O88466	0.070	0.056	1.038E-2	1888	0.058	0.043	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
15	AFDB:A0A0G2K7W4	0.084	0.086	1.703E-2	1348	0.059	0.061	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
16	AFDB:F4JUD2	0.106	0.144	6.820E-2	969	0.052	0.075	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
17	AFDB:D6W4T8	0.081	0.088	9.182E-2	1266	0.061	0.067	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
18	AFDB:Q9NWM3	0.047	0.113	1.931E-1	386	0.031	0.114	Q9NWM3.pdb.gz	CUED1_HUMAN CUE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CUEDC1 PE=1 SV=1
19	AFDB:Q9VDB7	0.037	0.042	2.354E-1	1108	0.076	0.096	Q9VDB7.pdb.gz	Q9VDB7_DROME LP06548p OS=Drosophila melanogaster OX=7227 GN=aus PE=1 SV=4
20	AFDB:O09130	0.047	0.100	3.016E-1	412	0.043	0.146	O09130.pdb.gz	NF2IP_MOUSE NFATC2-interacting protein OS=Mus musculus OX=10090 GN=Nfatc2ip PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EMW7	0.0	2897	2792	0.996	0.499	E7EMW7_HUMAN Ubiquitin protein ligase E3 component n-recognin 5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=1
2	O95071	0.0	2913	2799	1.000	0.500	UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2
3	P51592	0.0	604	2885	0.269	0.130	HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster OX=7227 GN=hyd PE=1 SV=3
4	Q62671	0.0	2815	2788	0.964	0.484	UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus OX=10116 GN=Ubr5 PE=1 SV=3
5	Q80TP3	0.0	2847	2792	0.974	0.488	UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus OX=10090 GN=Ubr5 PE=1 SV=2
6	A2AN08	3.82e-09	64.3	5180	0.018	0.005	UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1
7	Q5T4S7	3.98e-09	64.3	5183	0.018	0.005	UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1
8	Q9VLT5	4.48e-09	63.9	5322	0.018	0.005	POE_DROME Protein purity of essence OS=Drosophila melanogaster OX=7227 GN=poe PE=1 SV=1
9	Q9SRU2	2.80e-07	58.2	5098	0.017	0.005	BIG_ARATH Auxin transport protein BIG OS=Arabidopsis thaliana OX=3702 GN=BIG PE=1 SV=2
10	Q94251	0.007	43.5	936	0.012	0.018	DRE1_CAEEL F-box protein dre-1 OS=Caenorhabditis elegans OX=6239 GN=dre-1 PE=1 SV=3
11	Q86XK2	0.009	43.1	927	0.014	0.022	FBX11_HUMAN F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3
12	Q9VH60	0.009	43.1	1182	0.014	0.017	Q9VH60_DROME F-box protein 11, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXO11 PE=4 SV=1
13	Q7TPD1	0.010	43.1	930	0.014	0.022	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
14	Q7TSL3	0.011	42.7	843	0.014	0.024	FBX11_RAT F-box only protein 11 OS=Rattus norvegicus OX=10116 GN=Fbxo11 PE=2 SV=1
15	D4A7F0	0.027	41.6	1889	0.014	0.011	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
16	Q5U430	0.029	41.6	1889	0.014	0.011	UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus OX=10090 GN=Ubr3 PE=1 SV=3
17	F1QJX5	0.062	40.4	1863	0.014	0.011	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
18	O95714	0.12	39.7	4834	0.016	0.005	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
19	Q4U2R1	0.13	39.3	4836	0.016	0.005	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
20	P28745	0.67	36.6	539	0.014	0.037	RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11547 E3_UbLigase_EDD	9.5e-26	100.6	E3 ubiquitin ligase EDD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381717	0.959	Ubiquitin-conjugating enzyme E2 D2
2	9606.ENSP00000331901	0.944	Elongation factor 1-gamma
3	9606.ENSP00000441543	0.942	Polyubiquitin-C
4	9606.ENSP00000301764	0.925	DNA damage-binding protein 1
5	9606.ENSP00000319814	0.919	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
6	9606.ENSP00000378275	0.908	Polyadenylate-binding protein-interacting protein 2
7	9606.ENSP00000460348	0.893	Pre-mRNA-processing-splicing factor 8
8	9606.ENSP00000400906	0.890	Ubiquitin-conjugating enzyme E2L 3
9	9606.ENSP00000307208	0.887	Nucleosome-remodeling factor subunit BPTF
10	9606.ENSP00000272317	0.886	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000302530	0.881	Mitotic checkpoint serine/threonine-protein kinase BUB1
12	9606.ENSP00000290650	0.875	E3 ubiquitin-protein ligase UBR1
13	9606.ENSP00000261531	0.857	SNW domain-containing protein 1
14	9606.ENSP00000342105	0.846	Dual specificity tyrosine-phosphorylation-regulated kinase 2
15	9606.ENSP00000388107	0.843	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000304697	0.837	Polyubiquitin-B
17	9606.ENSP00000317123	0.836	U5 small nuclear ribonucleoprotein 200 kDa helicase
18	9606.ENSP00000361990	0.836	E3 ubiquitin-protein ligase UBR2
19	9606.ENSP00000386759	0.836	Histone-lysine N-methyltransferase SETD2
20	9606.ENSP00000360532	0.834	Cell division cycle 5-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070647	0.989	protein modification by small protein conjugation or removal
GO:0019222	0.987	regulation of metabolic process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0048519	0.935	negative regulation of biological process
GO:0009892	0.925	negative regulation of metabolic process
GO:0010605	0.913	negative regulation of macromolecule metabolic process
GO:0016567	0.883	protein ubiquitination
GO:0009987	0.872	cellular process
GO:0010468	0.866	regulation of gene expression
GO:0050794	0.794	regulation of cellular process
GO:0051172	0.733	negative regulation of nitrogen compound metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0031647	0.688	regulation of protein stability
GO:0080090	0.684	regulation of primary metabolic process
GO:0048523	0.680	negative regulation of cellular process
GO:0050896	0.674	response to stimulus
GO:0048583	0.633	regulation of response to stimulus
GO:0051716	0.595	cellular response to stimulus
GO:0030522	0.534	intracellular receptor signaling pathway
GO:0051246	0.489	regulation of protein metabolic process
GO:0048518	0.349	positive regulation of biological process
GO:0060341	0.349	regulation of cellular localization
GO:0044237	0.336	cellular metabolic process
GO:0019219	0.305	regulation of nucleobase-containing compound metabolic process
GO:1903320	0.300	regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0032991	0.322	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]