StarFunc result for job id O95073

User Input

>input (299 residues)
MVGKARSSNFTLSEKLDLLKLVKPYVKILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDR
PPRTAQGLRTLYKRLKEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDR
NHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQRE
EHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLK
EEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95073	1.000	1.000	3.222E-41	299	1.000	1.000	O95073.pdb.gz	FSBP_HUMAN Fibrinogen silencer-binding protein OS=Homo sapiens OX=9606 GN=FSBP PE=1 SV=1
2	AFDB:Q8NCY6	0.279	0.244	3.738E-5	345	0.201	0.174	Q8NCY6.pdb.gz	MSD4_HUMAN Myb/SANT-like DNA-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=MSANTD4 PE=1 SV=1
3	AFDB:Q96H12	0.282	0.305	1.847E-3	275	0.204	0.222	Q96H12.pdb.gz	MSD3_HUMAN Myb/SANT-like DNA-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MSANTD3 PE=1 SV=1
4	AFDB:Q9SYG2	0.280	0.231	1.961E-3	383	0.174	0.136	Q9SYG2.pdb.gz	ASIL1_ARATH Trihelix transcription factor ASIL1 OS=Arabidopsis thaliana OX=3702 GN=ASIL1 PE=1 SV=1
5	AFDB:Q8R4U1	0.199	0.155	4.542E-3	393	0.154	0.117	Q8R4U1.pdb.gz	MYPOP_MOUSE Myb-related transcription factor, partner of profilin OS=Mus musculus OX=10090 GN=Mypop PE=1 SV=1
6	AFDB:A0A384LCJ3	0.232	0.218	9.909E-3	321	0.161	0.150	A0A384LCJ3.pdb.gz	A0A384LCJ3_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53170 PE=1 SV=1
7	AFDB:Q86VE0	0.258	0.199	9.909E-3	399	0.157	0.118	Q86VE0.pdb.gz	MYPOP_HUMAN Myb-related transcription factor, partner of profilin OS=Homo sapiens OX=9606 GN=MYPOP PE=1 SV=2
8	AFDB:Q5T230	0.297	0.266	4.716E-2	341	0.151	0.132	Q5T230.pdb.gz	UTF1_HUMAN Undifferentiated embryonic cell transcription factor 1 OS=Homo sapiens OX=9606 GN=UTF1 PE=1 SV=1
9	AFDB:Q9LNC9	0.137	0.161	4.716E-2	246	0.114	0.138	Q9LNC9.pdb.gz	MYB13_ARATH Transcription factor MYB13 OS=Arabidopsis thaliana OX=3702 GN=MYB13 PE=1 SV=1
10	AFDB:Q39117	0.209	0.115	6.759E-2	575	0.137	0.071	Q39117.pdb.gz	TGT2_ARATH Trihelix transcription factor GT-2 OS=Arabidopsis thaliana OX=3702 GN=GT-2 PE=1 SV=1
11	PDB:5mqfL	0.165	0.147	2.238E-1	336	0.124	0.110	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
12	PDB:7dcoL	0.140	0.098	3.616E-1	435	0.144	0.099	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
13	PDB:5yzgL	0.155	0.112	6.997E-1	419	0.140	0.100	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5gmkc	0.085	0.064	9.445E-1	436	0.110	0.076	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
15	PDB:6j6gc	0.092	0.067	1.354	436	0.171	0.117	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
16	PDB:3jb9W	0.163	0.119	1.526	426	0.074	0.052	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:6id0L	0.154	0.100	1.721	475	0.097	0.061	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:1jfiB	0.104	0.204	2.060	135	0.047	0.104	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
19	PDB:5gm6c	0.126	0.091	2.060	415	0.097	0.070	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:5i32A	0.124	0.152	2.188	238	0.037	0.046	5i32A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95073	0.0	612	299	1.000	1.000	FSBP_HUMAN Fibrinogen silencer-binding protein OS=Homo sapiens OX=9606 GN=FSBP PE=1 SV=1
2	Q8MLR4	0.005	40.4	469	0.087	0.055	Q8MLR4_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=1 SV=1
3	O16114	0.006	40.4	484	0.087	0.054	O16114_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=2 SV=1
4	O17430	0.006	40.4	490	0.087	0.053	O17430_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=2 SV=1
5	O44203	0.006	40.4	484	0.087	0.054	O44203_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=2 SV=1
6	O61602	0.006	40.4	483	0.087	0.054	O61602_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=1 SV=1
7	A0A0B4KGD0	0.007	40.0	499	0.087	0.052	A0A0B4KGD0_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=1 SV=1
8	Q9W1M6	0.007	40.4	489	0.087	0.053	Q9W1M6_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=apt PE=1 SV=2
9	Q9U1N0	0.83	33.9	535	0.067	0.037	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
10	Q9R0M4	2.6	32.0	503	0.097	0.058	PODXL_MOUSE Podocalyxin OS=Mus musculus OX=10090 GN=Podxl PE=1 SV=2
11	Q9L4Q3	3.2	31.6	299	0.070	0.070	Q9L4Q3_ACEST Proline racemase OS=Acetoanaerobium sticklandii OX=1511 GN=prdF PE=3 SV=1
12	G5EGC7	3.5	31.6	279	0.050	0.054	G5EGC7_CAEEL Cadmium-inducible lysosomal protein CDR-5 OS=Caenorhabditis elegans OX=6239 GN=hrg-2 PE=1 SV=1
13	F4I3R1	5.0	31.2	975	0.060	0.018	F4I3R1_ARATH Peptidase M1 family protein OS=Arabidopsis thaliana OX=3702 GN=At1g63770 PE=1 SV=2
14	Q7GB25	6.5	31.2	1514	0.077	0.015	AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana OX=3702 GN=ABCC5 PE=2 SV=2
15	Q8NCY6	9.2	30.4	345	0.054	0.046	MSD4_HUMAN Myb/SANT-like DNA-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=MSANTD4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13873 Myb_DNA-bind_5	5.2e-18	76.1	Myb/SANT-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003938809.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010330850.1	0.679	Zinc finger protein 276 isoform X2
2	27679.XP_003926801.1	0.676	S1 RNA-binding domain-containing protein 1
3	27679.XP_010348577.1	0.673	Zinc finger and BTB domain-containing protein 48 isoform X1
4	27679.XP_003940636.1	0.661	Nuclear apoptosis-inducing factor 1
5	27679.XP_010349196.1	0.649	Zinc finger and BTB domain-containing protein 10 isoform X1
6	27679.XP_010346093.1	0.573	Homeobox-containing protein 1 isoform X1
7	27679.XP_003945223.2	0.571	LOW QUALITY PROTEIN: calcyclin-binding protein
8	27679.XP_003944740.1	0.568	Zinc finger protein 524
9	27679.XP_010346884.1	0.567	Nuclear receptor subfamily 1 group I member 3 isoform X1
10	27679.XP_010342348.1	0.564	5' exonuclease Apollo
11	27679.XP_010336927.1	0.561	Zinc finger protein 64 homolog, isoforms 3 and 4-like
12	27679.XP_010336928.1	0.561	Zinc finger protein 827
13	27679.XP_003931082.1	0.558	Krueppel-like factor 12
14	27679.XP_010349008.1	0.527	Binds the telomeric double-stranded 5'-TTAGGG-3' repeat.
15	27679.XP_010338624.1	0.526	Nuclear receptor subfamily 2 group C member 1
16	27679.XP_003922655.1	0.505	Early growth response protein 4 isoform X1
17	27679.XP_003937164.1	0.504	Belongs to the eIF-2B alpha/beta/delta subunits family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0097159	0.334	organic cyclic compound binding
GO:1901363	0.329	heterocyclic compound binding
GO:0003676	0.320	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0080090	0.972	regulation of primary metabolic process
GO:0009987	0.970	cellular process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.924	regulation of biosynthetic process
GO:0048518	0.921	positive regulation of biological process
GO:0010468	0.891	regulation of gene expression
GO:0010556	0.889	regulation of macromolecule biosynthetic process
GO:0031326	0.883	regulation of cellular biosynthetic process
GO:0051252	0.855	regulation of RNA metabolic process
GO:0006355	0.849	regulation of DNA-templated transcription
GO:0051173	0.826	positive regulation of nitrogen compound metabolic process
GO:0010604	0.821	positive regulation of macromolecule metabolic process
GO:0048522	0.817	positive regulation of cellular process
GO:0048523	0.786	negative regulation of cellular process
GO:0006357	0.704	regulation of transcription by RNA polymerase II
GO:0031325	0.666	positive regulation of cellular metabolic process
GO:0045935	0.654	positive regulation of nucleobase-containing compound metabolic process
GO:0008152	0.587	metabolic process
GO:0031328	0.536	positive regulation of cellular biosynthetic process
GO:0071704	0.534	organic substance metabolic process
GO:0044238	0.518	primary metabolic process
GO:0006807	0.490	nitrogen compound metabolic process
GO:0051172	0.475	negative regulation of nitrogen compound metabolic process
GO:0044237	0.471	cellular metabolic process
GO:0010557	0.466	positive regulation of macromolecule biosynthetic process
GO:0010605	0.446	negative regulation of macromolecule metabolic process
GO:0043170	0.401	macromolecule metabolic process
GO:1902680	0.369	positive regulation of RNA biosynthetic process
GO:0071840	0.368	cellular component organization or biogenesis
GO:0050896	0.347	response to stimulus
GO:0016043	0.344	cellular component organization
GO:1903508	0.341	positive regulation of nucleic acid-templated transcription
GO:0031324	0.313	negative regulation of cellular metabolic process
GO:0045893	0.310	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.388	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]