StarFunc result for job id O95076

User Input

>input (343 residues)
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPY
LPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSN
LQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDV
YAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHP
QLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSI
HGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70137	0.459	0.459	9.525E-45	343	0.918	0.918	O70137.pdb.gz	ALX3_MOUSE Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1
2	AFDB:O42358	0.214	0.249	8.270E-9	292	0.251	0.295	O42358.pdb.gz	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
3	AFDB:F1RCT9	0.197	0.240	1.607E-8	280	0.233	0.286	F1RCT9.pdb.gz	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
4	AFDB:O42115	0.212	0.163	1.718E-8	453	0.297	0.225	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
5	AFDB:Q94398	0.230	0.279	2.736E-8	276	0.213	0.264	Q94398.pdb.gz	HM08_CAEEL Homeobox protein ceh-8 OS=Caenorhabditis elegans OX=6239 GN=ceh-8 PE=1 SV=3
6	AFDB:Q9PWR3	0.222	0.233	3.569E-8	326	0.213	0.224	Q9PWR3.pdb.gz	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1
7	AFDB:Q2M1V0	0.220	0.300	4.976E-8	245	0.222	0.310	Q2M1V0.pdb.gz	ISX_HUMAN Intestine-specific homeobox OS=Homo sapiens OX=9606 GN=ISX PE=1 SV=2
8	AFDB:A1A546	0.219	0.303	6.938E-8	240	0.216	0.308	A1A546.pdb.gz	ISX_MOUSE Intestine-specific homeobox OS=Mus musculus OX=10090 GN=Isx PE=2 SV=2
9	AFDB:Q9W5Z2	0.217	0.235	9.673E-8	314	0.210	0.229	Q9W5Z2.pdb.gz	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1
10	AFDB:Q3T498	0.199	0.237	1.441E-7	285	0.245	0.295	Q3T498.pdb.gz
11	PDB:2hi3A	0.152	0.619	1.637E-2	73	0.064	0.301	2hi3A.pdb.gz
12	PDB:4egcA	0.145	0.092	1.749E-2	539	0.047	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.112	0.224	1.078	153	0.038	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.113	0.324	2.095	86	0.023	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5mrca	0.111	0.198	2.393	177	0.038	0.073	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:4ldzA	0.138	0.229	3.122	196	0.017	0.031	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
17	PDB:5z56L	0.101	0.101	3.565	342	0.029	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:2cyyA	0.095	0.197	4.072	151	0.035	0.079	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
19	PDB:7b93E	0.070	0.103	4.072	215	0.023	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
20	PDB:5nr5A	0.115	0.311	4.971	113	0.023	0.071	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70137	0.0	600	343	0.918	0.918	ALX3_MOUSE Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1
2	O95076	0.0	691	343	1.000	1.000	ALX3_HUMAN Homeobox protein aristaless-like 3 OS=Homo sapiens OX=9606 GN=ALX3 PE=1 SV=2
3	Q6RW14	0.0	593	343	0.910	0.910	Q6RW14_RAT Aristaless-related ALX3 OS=Rattus norvegicus OX=10116 GN=Alx3 PE=2 SV=1
4	Q63087	8.48e-68	217	326	0.347	0.365	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1
5	Q8C8B0	1.96e-67	216	326	0.332	0.350	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
6	Q15699	5.64e-67	215	326	0.318	0.334	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
7	V9HWA7	5.64e-67	215	326	0.318	0.334	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
8	Q1LVQ7	1.73e-63	206	320	0.335	0.359	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
9	O35137	2.70e-62	205	399	0.309	0.266	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
10	Q9H161	1.09e-61	204	411	0.321	0.268	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
11	Q8T0V5	4.68e-32	125	357	0.198	0.190	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
12	Q9XZU0	5.08e-32	124	357	0.198	0.190	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
13	O42115	1.60e-29	119	453	0.149	0.113	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
14	A6YP92	3.60e-29	119	566	0.149	0.090	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
15	Q96QS3	4.62e-29	119	562	0.149	0.091	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
16	O35085	5.19e-29	119	564	0.149	0.090	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
17	O42356	1.68e-28	114	330	0.239	0.248	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
18	A6NNA5	2.06e-28	113	263	0.222	0.289	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
19	Q8BYH0	2.41e-28	112	263	0.222	0.289	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
20	Q06453	4.65e-28	115	408	0.143	0.120	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	6.5	18.1	Homeobox KN domain
2	PF00046 Homeodomain	7.4e-20	81.9	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358807

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364320	0.830	mRNA turnover protein 4 homolog
2	9606.ENSP00000330199	0.825	Sodium-dependent neutral amino acid transporter SLC6A17
3	9606.ENSP00000334044	0.814	Ubiquitin-like protein 4B
4	9606.ENSP00000358799	0.727	Putative RNA-binding protein 15
5	9606.ENSP00000275461	0.699	Fer3-like protein
6	9606.ENSP00000347583	0.696	Major facilitator superfamily domain containing 12
7	9606.ENSP00000367880	0.649	GPI ethanolamine phosphate transferase 3
8	9606.ENSP00000256246	0.644	Testis-expressed protein 15
9	9606.ENSP00000340226	0.630	LIM homeobox transcription factor 1-alpha
10	9606.ENSP00000344087	0.621	Autism susceptibility gene 2 protein
11	9606.ENSP00000358810	0.615	Striatin-interacting protein 1
12	9606.ENSP00000467290	0.612	Semaphorin-6B
13	9606.ENSP00000362390	0.601	T-box transcription factor TBX22
14	9606.ENSP00000288135	0.587	Mast/stem cell growth factor receptor Kit
15	9606.ENSP00000369390	0.584	Cyclin-dependent kinase 14
16	9606.ENSP00000451223	0.556	Prospero homeobox protein 2
17	9606.ENSP00000414657	0.554	Protein odd-skipped-related 2
18	9606.ENSP00000244137	0.536	Xaa-Pro dipeptidase
19	9606.ENSP00000365898	0.531	Forkhead box protein B2
20	9606.ENSP00000295454	0.528	Gamma-aminobutyric acid receptor subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.996	protein binding
GO:0000981	0.988	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.980	transcription cis-regulatory region binding
GO:0000977	0.805	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0032502	0.982	developmental process
GO:0010468	0.979	regulation of gene expression
GO:0051252	0.976	regulation of RNA metabolic process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0010556	0.969	regulation of macromolecule biosynthetic process
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0048856	0.939	anatomical structure development
GO:0032501	0.938	multicellular organismal process
GO:0007275	0.832	multicellular organism development
GO:0009987	0.827	cellular process
GO:0006357	0.805	regulation of transcription by RNA polymerase II
GO:0048731	0.611	system development
GO:0009653	0.410	anatomical structure morphogenesis
GO:0048518	0.348	positive regulation of biological process
GO:0048522	0.325	positive regulation of cellular process
GO:0048513	0.324	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.410	nuclear lumen
GO:0005737	0.374	cytoplasm
GO:0005654	0.370	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]