StarFunc result for job id O95104

User Input

>input (1147 residues)
MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKV
PGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKN
GVFKIEIIQPLLDMAAGTSNAAPVAENVTNNEGSPPPPVKVSSEPPTQATPNSVPAVPQL
PSSDAFAAVAQLFQTTQGQQLQQILQTFQQPPKPQSPALDNAVMAQVQAITAQLKTTPTQ
PSEQKAAFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKEDTTAVTTTAPAAAVPPAPTA
TVPAAAAPAAASPPPPQAPFGFPGDGMQQPAYTQHQNMDQFQPRMMGIQQDPMHHQVPLP
PNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPC
IQEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSPRSRSQE
RRDREKERERRQKGLPQVKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPIESINMI
PPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDVELGVT
YIPWDKVKPEELESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNGGAETSHTEPVSPIPK
PLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPP
PPPFLRPGFNPMHLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAGINEDTTKDLS
IGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPTNLPTPPVTQPVSLLGTQGVAPGPVI
GLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFAMP
PPHGMKGPFPPHGPFVRPGGMPGLGGPGPGPGGPEDRDGRQQPPQQPQQQPQPQAPQQPQ
QQQQQQPPPSQQPPPTQQQPQQFRNDNRQQFNSGRDQERFGRRSFGNRVENDRERYGNRN
DDRDNSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEK
PEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLKPSEELPAEATSSVEPEKDSG
SAAEAPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95104	0.999	0.999	0.000	1147	1.000	1.000	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
2	AFDB:Q63627	0.334	0.322	0.000	1200	0.880	0.841	Q63627.pdb.gz	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
3	AFDB:Q9UPN6	0.158	0.145	2.852E-57	1271	0.405	0.365	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
4	AFDB:A8DYK5	0.154	0.138	5.279E-45	1306	0.320	0.281	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
5	AFDB:O94913	0.106	0.079	3.727E-8	1555	0.191	0.141	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
6	AFDB:F1QGD0	0.107	0.085	1.566E-6	1457	0.180	0.142	F1QGD0.pdb.gz
7	AFDB:A8JNQ4	0.065	0.090	6.275E-6	796	0.122	0.176	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
8	PDB:3lqvB	0.070	0.585	1.594E-5	115	0.020	0.200	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	PDB:6id0O	0.063	0.240	5.161E-5	290	0.024	0.097	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
10	PDB:6qx91K	0.064	0.343	7.110E-5	201	0.032	0.184	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
11	AFDB:E9PT37	0.071	0.068	1.063E-4	1207	0.134	0.128	E9PT37.pdb.gz	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
12	AFDB:A6NDE4	0.067	0.150	1.317E-4	496	0.081	0.188	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
13	PDB:6n7pY	0.060	0.479	1.762E-4	138	0.022	0.181	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
14	PDB:5oobB	0.058	0.411	1.961E-4	152	0.019	0.145	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
15	PDB:6ff7X	0.065	0.393	3.926E-4	171	0.014	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:6n7pA	0.059	0.351	4.608E-4	186	0.014	0.086	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
17	PDB:7oqcF	0.069	0.271	7.860E-4	267	0.014	0.060	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
18	AFDB:Q5T481	0.073	0.069	9.495E-4	1227	0.133	0.124	Q5T481.pdb.gz	RBM20_HUMAN RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=4
19	PDB:3pgwP	0.062	0.567	1.027E-3	113	0.013	0.133	3pgwP.pdb.gz
20	PDB:6zmwo	0.058	0.759	1.142E-3	77	0.018	0.273	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95104	0.0	2293	1147	1.000	1.000	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
2	Q63627	0.0	576	1200	0.284	0.272	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
3	A0A0A0MT33	1.21e-73	270	1349	0.142	0.121	A0A0A0MT33_HUMAN SR-related CTD associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
4	Q9UPN6	1.26e-73	270	1271	0.142	0.128	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
5	Q63623	7.25e-72	264	1268	0.140	0.127	SCAF8_RAT SR-related and CTD-associated factor 8 OS=Rattus norvegicus OX=10116 GN=Scaf8 PE=1 SV=1
6	A8DYK5	4.82e-56	215	1306	0.084	0.074	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
7	Q9SX79	5.74e-07	55.8	432	0.021	0.056	RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana OX=3702 GN=RBP47C PE=2 SV=1
8	Q9UTE3	9.10e-06	52.4	620	0.044	0.082	SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=seb1 PE=1 SV=3
9	Q5U393	0.004	43.9	1457	0.061	0.048	Q5U393_DANRE Cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:175013 PE=1 SV=1
10	Q8CGZ0	0.004	43.9	936	0.037	0.045	CHERP_MOUSE Calcium homeostasis endoplasmic reticulum protein OS=Mus musculus OX=10090 GN=Cherp PE=1 SV=1
11	Q8IWX8	0.004	43.5	916	0.036	0.045	CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3
12	D3ZAX5	0.019	41.6	946	0.037	0.045	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
13	P08621	0.020	41.2	437	0.020	0.053	RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2
14	A0A8I6G5W4	0.023	40.8	436	0.020	0.053	A0A8I6G5W4_RAT U1 small nuclear ribonucleoprotein 70 kDa OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
15	B2RZ74	0.024	40.8	451	0.020	0.051	B2RZ74_RAT Small nuclear ribonucleoprotein U1 subunit 70 OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
16	Q62376	0.024	40.8	448	0.020	0.051	RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus OX=10090 GN=Snrnp70 PE=1 SV=2
17	F1QBY1	0.23	38.1	2876	0.030	0.012	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
18	O14776	0.54	37.0	1098	0.032	0.034	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
19	Q6PGZ3	0.66	36.6	629	0.021	0.038	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
20	Q9VM49	1.5	35.4	594	0.020	0.039	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	1.5e-18	78.6	CID domain
2	PF00076 RRM_1	1.1e-05	36.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16842 RRM_occluded	22	16.4	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224140	0.912	Probable helicase senataxin
2	9606.ENSP00000480158	0.902	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000298281	0.821	Pre-mRNA cleavage complex 2 protein Pcf11
4	9606.ENSP00000383168	0.753	Poly(rC)-binding protein 3
5	9606.ENSP00000238112	0.732	Cleavage and polyadenylation specificity factor subunit 3
6	9606.ENSP00000381984	0.724	Regulation of nuclear pre-mRNA domain-containing protein 1A
7	9606.ENSP00000383421	0.722	Splicing regulator RBM11
8	9606.ENSP00000362532	0.710	Regulation of nuclear pre-mRNA domain-containing protein 1B
9	9606.ENSP00000352438	0.709	Poly(rC)-binding protein 2
10	9606.ENSP00000296328	0.701	UBX domain-containing protein 7
11	9606.ENSP00000358064	0.701	Regulation of nuclear pre-mRNA domain containing 2
12	9606.ENSP00000326806	0.680	Nuclear cap-binding protein subunit 2
13	9606.ENSP00000366396	0.662	5'-3' exoribonuclease 2
14	9606.ENSP00000298875	0.651	Cleavage and polyadenylation specificity factor subunit 2
15	9606.ENSP00000364289	0.650	Nuclear cap-binding protein subunit 1
16	9606.ENSP00000417175	0.642	Vesicle-associated membrane protein-associated protein B/C
17	9606.ENSP00000211998	0.634	Vinculin
18	9606.ENSP00000250101	0.629	Thioredoxin domain-containing protein 17
19	9606.ENSP00000348128	0.629	Supervillin
20	9606.ENSP00000333255	0.624	Vacuolar ATPase assembly integral membrane protein VMA21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:1990269	1.000	RNA polymerase II C-terminal domain phosphoserine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0051252	0.988	regulation of RNA metabolic process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0048523	0.983	negative regulation of cellular process
GO:2001141	0.973	regulation of RNA biosynthetic process
GO:0010605	0.972	negative regulation of macromolecule metabolic process
GO:0051172	0.955	negative regulation of nitrogen compound metabolic process
GO:0043244	0.952	regulation of protein-containing complex disassembly
GO:0006355	0.951	regulation of DNA-templated transcription
GO:0045934	0.890	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.882	negative regulation of RNA metabolic process
GO:0006357	0.876	regulation of transcription by RNA polymerase II
GO:0010558	0.871	negative regulation of macromolecule biosynthetic process
GO:0031327	0.866	negative regulation of cellular biosynthetic process
GO:0009987	0.821	cellular process
GO:0045892	0.815	negative regulation of DNA-templated transcription
GO:0000122	0.783	negative regulation of transcription by RNA polymerase II
GO:0008152	0.775	metabolic process
GO:0051129	0.774	negative regulation of cellular component organization
GO:0044237	0.757	cellular metabolic process
GO:0071704	0.755	organic substance metabolic process
GO:0044238	0.748	primary metabolic process
GO:0043242	0.748	negative regulation of protein-containing complex disassembly
GO:0006807	0.745	nitrogen compound metabolic process
GO:0043170	0.710	macromolecule metabolic process
GO:0031554	0.679	regulation of termination of DNA-templated transcription
GO:0006139	0.569	nucleobase-containing compound metabolic process
GO:0090304	0.553	nucleic acid metabolic process
GO:0016070	0.515	RNA metabolic process
GO:0010467	0.457	gene expression
GO:0006396	0.395	RNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.490	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]