StarFunc result for job id O95150

User Input

>input (251 residues)
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95150	1.000	1.000	1.101E-44	251	1.000	1.000	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
2	AFDB:Q8K3Y7	0.686	0.684	1.013E-32	252	0.697	0.694	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
3	AFDB:P48023	0.527	0.472	2.507E-16	281	0.247	0.221	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
4	AFDB:P41047	0.503	0.455	2.796E-16	279	0.255	0.229	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
5	AFDB:O14788	0.533	0.426	5.682E-16	317	0.251	0.199	O14788.pdb.gz	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
6	AFDB:Q9DEP9	0.536	0.528	8.791E-16	255	0.251	0.247	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
7	AFDB:Q0PKX7	0.551	0.523	9.284E-16	268	0.235	0.220	Q0PKX7.pdb.gz	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
8	AFDB:O43557	0.530	0.554	9.804E-16	240	0.263	0.275	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
9	AFDB:A0A0U5J7B5	0.578	0.505	2.617E-15	292	0.255	0.219	A0A0U5J7B5.pdb.gz	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
10	AFDB:F1Q767	0.541	0.440	2.764E-15	317	0.275	0.218	F1Q767.pdb.gz
11	PDB:5h4bA	0.382	0.657	1.678E-6	136	0.068	0.125	5h4bA.pdb.gz
12	PDB:5kc6B	0.390	0.631	2.063E-5	144	0.064	0.111	5kc6B.pdb.gz
13	PDB:7e57B	0.318	0.617	2.300E-5	123	0.108	0.220	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:4fixA	0.216	0.099	1.094E-2	629	0.068	0.027	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:3cl5A	0.204	0.162	1.602E-2	358	0.060	0.042	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
16	PDB:6oj0A	0.239	0.309	1.787E-2	178	0.060	0.084	6oj0A.pdb.gz
17	PDB:7drtB	0.189	0.117	2.104E-2	496	0.072	0.036	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
18	PDB:1zvfA	0.094	0.119	2.222E-2	176	0.056	0.080	1zvfA.pdb.gz
19	PDB:3i26D	0.153	0.120	2.764E-2	369	0.056	0.038	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
20	PDB:5nxsA	0.199	0.181	2.764E-2	290	0.096	0.083	5nxsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95150	0.0	527	251	1.000	1.000	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
2	Q8K3Y7	7.69e-125	356	252	0.697	0.694	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
3	P01375	2.81e-18	82.8	233	0.207	0.223	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
4	C1K3N5	2.87e-18	82.8	232	0.207	0.224	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
5	Q06599	1.22e-17	81.3	234	0.211	0.226	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
6	Q9I976	2.98e-17	80.5	246	0.183	0.187	Q9I976_ONCMY Putative tumour necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=TNF-alpha PE=2 SV=1
7	Q9DEP9	5.31e-17	80.1	255	0.175	0.173	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
8	Q9I970	8.85e-17	79.3	246	0.179	0.183	Q9I970_ONCMY Tumor necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=tnfa PE=3 SV=1
9	P06804	5.05e-16	77.0	235	0.199	0.213	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
10	O43557	9.25e-16	76.3	240	0.219	0.229	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
11	B3GDZ6	1.87e-15	75.1	232	0.187	0.203	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
12	P23563	1.87e-15	75.1	232	0.187	0.203	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
13	P16599	3.45e-15	74.7	235	0.203	0.217	TNFA_RAT Tumor necrosis factor OS=Rattus norvegicus OX=10116 GN=Tnf PE=2 SV=1
14	P48023	4.71e-15	75.1	281	0.199	0.178	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
15	Q53ZZ1	4.71e-15	75.1	281	0.199	0.178	Q53ZZ1_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=TNFSF6 PE=2 SV=1
16	P41047	1.61e-14	73.6	279	0.195	0.176	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
17	Q0VHD7	2.39e-14	72.8	281	0.195	0.174	Q0VHD7_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=2 SV=1
18	Q06332	2.42e-14	71.6	202	0.227	0.282	TNFB_RAT Lymphotoxin-alpha OS=Rattus norvegicus OX=10116 GN=Lta PE=3 SV=1
19	Q08CQ3	5.79e-14	71.2	234	0.183	0.197	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
20	Q1L8A5	6.41e-14	71.2	234	0.183	0.197	Q1L8A5_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	1.7e-36	136.4	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359013	0.999	Tumor necrosis factor receptor superfamily, member 6b, decoy
2	9606.ENSP00000367013	0.999	Tumor necrosis factor receptor superfamily member 25
3	9606.ENSP00000480348	0.995	annotation not available
4	9606.ENSP00000300589	0.678	Nucleotide-binding oligomerization domain-containing protein 2
5	9606.ENSP00000162749	0.659	Tumor necrosis factor receptor superfamily member 1A
6	9606.ENSP00000321345	0.653	Interleukin-23 receptor
7	9606.ENSP00000407763	0.652	Coiled-coil domain containing 122
8	9606.ENSP00000331288	0.643	Stimulator of interferon genes protein
9	9606.ENSP00000391747	0.624	Laccase domain-containing protein 1
10	9606.ENSP00000223795	0.619	Tumor necrosis factor ligand superfamily member 8
11	9606.ENSP00000459533	0.615	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
12	9606.ENSP00000359297	0.602	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
13	9606.ENSP00000428220	0.594	Immunity-related GTPase family M protein
14	9606.ENSP00000370748	0.590	Isopentenyl-diphosphate Delta-isomerase 1
15	9606.ENSP00000280357	0.581	Interleukin-18
16	9606.ENSP00000375872	0.566	Autophagy-related protein 16-1
17	9606.ENSP00000480828	0.562	Squalene synthase
18	9606.ENSP00000385470	0.560	Tumor necrosis factor ligand superfamily member 18
19	9606.ENSP00000385675	0.558	Interleukin-6
20	9606.ENSP00000263341	0.539	Interleukin-1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.881	cytokine receptor binding
GO:0032813	0.726	tumor necrosis factor receptor superfamily binding
GO:0098772	0.476	molecular function regulator activity
GO:0140677	0.412	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065009	0.995	regulation of molecular function
GO:0051246	0.995	regulation of protein metabolic process
GO:0043280	0.991	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.985	response to stimulus
GO:0048522	0.942	positive regulation of cellular process
GO:0042325	0.924	regulation of phosphorylation
GO:0023052	0.922	signaling
GO:0006919	0.921	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007154	0.920	cell communication
GO:0051716	0.889	cellular response to stimulus
GO:0001932	0.879	regulation of protein phosphorylation
GO:0007165	0.869	signal transduction
GO:0001934	0.869	positive regulation of protein phosphorylation
GO:0051239	0.517	regulation of multicellular organismal process
GO:0010468	0.511	regulation of gene expression
GO:0002376	0.497	immune system process
GO:0051240	0.450	positive regulation of multicellular organismal process
GO:0048583	0.413	regulation of response to stimulus
GO:0001819	0.412	positive regulation of cytokine production
GO:0042221	0.362	response to chemical
GO:0048584	0.333	positive regulation of response to stimulus
GO:0023051	0.316	regulation of signaling
GO:0010646	0.316	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.445	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]