StarFunc result for job id O95155

User Input

>input (1302 residues)
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAA
SQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSP
QAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPR
SLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDY
FKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVF
AEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSY
MAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITL
PNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRL
RAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSP
QALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHP
LSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSG
KQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDE
RVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVEN
PEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIA
IEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M8V2	0.795	0.881	0.000	1173	0.877	0.974	F1M8V2.pdb.gz	F1M8V2_RAT Ubiquitin conjugation factor E4 OS=Rattus norvegicus OX=10116 GN=Ube4b PE=1 SV=3
2	AFDB:O95155	1.000	1.000	0.000	1302	1.000	1.000	O95155.pdb.gz	UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1
3	PDB:3m62A	0.550	0.731	4.902E-34	955	0.187	0.254	3m62A.pdb.gz
4	AFDB:Q54XY4	0.094	0.085	7.438E-6	1582	0.118	0.097	Q54XY4.pdb.gz	SCAA_DICDI Sca1 complex scaffold protein scaA OS=Dictyostelium discoideum OX=44689 GN=scaA PE=1 SV=1
5	AFDB:A0A1D8PRP3	0.069	0.058	1.742E-5	1704	0.138	0.106	A0A1D8PRP3.pdb.gz	A0A1D8PRP3_CANAL Mms22p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MMS22 PE=4 SV=1
6	AFDB:Q9VPR5	0.077	0.076	2.154E-5	1340	0.128	0.125	Q9VPR5.pdb.gz	Q9VPR5_DROME Splicing factor 3b subunit 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sf3b1 PE=1 SV=2
7	AFDB:Q38CX9	0.094	0.091	1.361E-4	1378	0.116	0.110	Q38CX9.pdb.gz	Q38CX9_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2660 PE=4 SV=1
8	AFDB:F4K0Y5	0.081	0.088	1.514E-4	1165	0.136	0.152	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
9	AFDB:Q55FT4	0.161	0.108	4.385E-4	2247	0.123	0.071	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
10	PDB:7t3rA	0.116	0.086	5.350E-4	2130	0.097	0.059	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
11	AFDB:E5FYH1	0.061	0.052	5.620E-4	1653	0.105	0.083	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
12	PDB:3gjxA	0.098	0.113	6.165E-4	1041	0.086	0.108	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
13	AFDB:G5E870	0.103	0.078	6.251E-4	2025	0.100	0.064	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
14	PDB:7jq9A	0.101	0.075	1.345E-3	2427	0.076	0.041	7jq9A.pdb.gz
15	PDB:5oqrA	0.094	0.142	1.550E-3	751	0.073	0.126	5oqrA.pdb.gz
16	PDB:6n1zA	0.122	0.149	1.606E-3	961	0.065	0.087	6n1zA.pdb.gz
17	PDB:7ni5A	0.094	0.058	1.917E-3	2791	0.081	0.038	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
18	PDB:7t3qA	0.137	0.094	1.986E-3	2103	0.073	0.045	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:6xu2A	0.138	0.159	2.289E-3	1091	0.073	0.087	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:3nd2A	0.101	0.136	2.457E-3	861	0.086	0.130	3nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M8V2	0.0	1867	1173	0.679	0.754	F1M8V2_RAT Ubiquitin conjugation factor E4 OS=Rattus norvegicus OX=10116 GN=Ube4b PE=1 SV=3
2	O95155	0.0	2692	1302	1.000	1.000	UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1
3	Q9ES00	0.0	1867	1173	0.679	0.754	UBE4B_MOUSE Ubiquitin conjugation factor E4 B OS=Mus musculus OX=10090 GN=Ube4b PE=1 SV=3
4	Q9HE05	2.54e-124	412	1010	0.210	0.271	UFD2_SCHPO Ubiquitin conjugation factor E4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ufd2 PE=2 SV=1
5	O44007	7.96e-114	385	1089	0.221	0.264	O44007_DICDI NOSA OS=Dictyostelium discoideum OX=44689 GN=nosA PE=2 SV=1
6	Q09349	4.00e-110	372	984	0.215	0.285	UBE4_CAEEL Ubiquitin conjugation factor E4 ufd-2 OS=Caenorhabditis elegans OX=6239 GN=ufd-2 PE=1 SV=2
7	Q9LF41	1.66e-104	358	1038	0.201	0.252	UBE4_ARATH Probable ubiquitin conjugation factor E4 OS=Arabidopsis thaliana OX=3702 GN=PUB1 PE=2 SV=1
8	P54860	4.13e-88	310	961	0.171	0.231	UFD2_YEAST E4 ubiquitin-protein ligase UFD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD2 PE=1 SV=3
9	Q14139	2.32e-74	271	1066	0.193	0.235	UBE4A_HUMAN Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2
10	E9Q735	2.09e-62	234	1028	0.184	0.232	UBE4A_MOUSE Ubiquitin conjugation factor E4 A OS=Mus musculus OX=10090 GN=Ube4a PE=1 SV=1
11	B1AQ61	8.54e-41	147	100	0.055	0.710	B1AQ61_HUMAN Ubiquitination factor E4B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1
12	Q925F4	0.004	43.9	539	0.021	0.050	RNF37_MOUSE RING finger protein 37 OS=Mus musculus OX=10090 GN=Ubox5 PE=1 SV=2
13	Q9SRT0	0.008	42.7	460	0.020	0.057	PUB9_ARATH U-box domain-containing protein 9 OS=Arabidopsis thaliana OX=3702 GN=PUB9 PE=1 SV=1
14	G5ECY6	0.022	40.8	266	0.018	0.086	G5ECY6_CAEEL Hsp70-interacting protein OS=Caenorhabditis elegans OX=6239 GN=chn-1 PE=1 SV=1
15	Q9JIK1	0.024	41.6	862	0.044	0.066	CDHR5_RAT Cadherin-related family member 5 OS=Rattus norvegicus OX=10116 GN=Cdhr5 PE=1 SV=1
16	Q3E9F6	0.025	41.2	445	0.018	0.054	PUB47_ARATH Putative U-box domain-containing protein 47 OS=Arabidopsis thaliana OX=3702 GN=PUB47 PE=3 SV=1
17	Q9XYW6	0.033	40.4	289	0.039	0.176	Q9XYW6_DROME Carboxy terminus of Hsp70-interacting protein OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=2 SV=1
18	Q5ZRQ0	0.036	40.0	246	0.015	0.081	LUBX_LEGPH E3 ubiquitin-protein ligase LubX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lubX PE=1 SV=1
19	Q9SRS9	0.039	40.0	278	0.032	0.151	CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana OX=3702 GN=CHIP PE=1 SV=1
20	Q5VRH9	0.042	40.4	611	0.024	0.051	PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04564 U-box	5.1e-26	102.0	U-box domain
2	PF10408 Ufd2P_core	4.6e-193	654.9	Ubiquitin elongating factor core

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000365576	0.993	Ubiquilin-1
3	9606.ENSP00000349722	0.978	Ubiquitin conjugating enzyme E2 D3
4	9606.ENSP00000350708	0.970	UV excision repair protein RAD23 homolog B
5	9606.ENSP00000467024	0.955	UV excision repair protein RAD23 homolog A
6	9606.ENSP00000268876	0.953	Protein unc-45 homolog B
7	9606.ENSP00000367545	0.936	Tumor protein p73
8	9606.ENSP00000457703	0.931	Ubiquitin-like protein 7
9	9606.ENSP00000366410	0.922	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
10	9606.ENSP00000381717	0.910	Ubiquitin-conjugating enzyme E2 D2
11	9606.ENSP00000407487	0.903	Protein unc-45 homolog A
12	9606.ENSP00000478320	0.892	Ataxin-3
13	9606.ENSP00000219548	0.883	E3 ubiquitin-protein ligase CHIP
14	9606.ENSP00000263202	0.883	Ubiquitin recognition factor in ER-associated degradation protein 1
15	9606.ENSP00000269305	0.880	Cellular tumor antigen p53
16	9606.ENSP00000373696	0.880	E3 ubiquitin-protein ligase TRIP12
17	9606.ENSP00000331487	0.866	Nuclear protein localization protein 4 homolog
18	9606.ENSP00000296328	0.865	UBX domain-containing protein 7
19	9606.ENSP00000380460	0.853	Phospholipase A-2-activating protein
20	9606.ENSP00000386741	0.848	N-chimaerin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.962	enzyme binding
GO:0003824	0.943	catalytic activity
GO:0140096	0.927	catalytic activity, acting on a protein
GO:0016740	0.907	transferase activity
GO:0019787	0.843	ubiquitin-like protein transferase activity
GO:0004842	0.821	ubiquitin-protein transferase activity
GO:0061630	0.539	ubiquitin protein ligase activity
GO:0051117	0.315	ATPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0065007	0.986	biological regulation
GO:0050896	0.986	response to stimulus
GO:0050794	0.980	regulation of cellular process
GO:0019538	0.978	protein metabolic process
GO:0006511	0.974	ubiquitin-dependent protein catabolic process
GO:0051716	0.945	cellular response to stimulus
GO:0023052	0.891	signaling
GO:0007154	0.878	cell communication
GO:0010498	0.778	proteasomal protein catabolic process
GO:0007165	0.671	signal transduction
GO:0070647	0.562	protein modification by small protein conjugation or removal
GO:0043161	0.435	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0032446	0.387	protein modification by small protein conjugation
GO:0008219	0.331	cell death
GO:0006950	0.315	response to stress
GO:0009411	0.310	response to UV
GO:0097190	0.308	apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000151	0.995	ubiquitin ligase complex
GO:0005737	0.972	cytoplasm
GO:0005829	0.952	cytosol
GO:0005634	0.915	nucleus
GO:0012505	0.744	endomembrane system
GO:0031981	0.606	nuclear lumen
GO:0005654	0.581	nucleoplasm
GO:0016020	0.580	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.907	Transferases.

[back to server]