StarFunc result for job id O95163

User Input

>input (1332 residues)
MRNLKLFRTLEFRDIQGPGNPQCFSLRTEQGTVLIGSEHGLIEVDPVSREVKNEVSLVAE
GFLPEDGSGRIVGVQDLLDQESVCVATASGDVILCSLSTQQLECVGSVASGISVMSWSPD
QELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQFHGSEGRQAAF
QMQMHESALPWDDHRPQVTWRGDGQFFAVSVVCPETGARKVRVWNREFALQSTSEPVAGL
GPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTLPFLKDEVKVNDLLWNADSSV
LAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLMWDPVTPYRLH
VLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLF
PHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVGGSGFKVCLRTP
HLEKRYKIQFENNEDQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHHLTAASSEMDE
EHGQLNVSSSAAVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAIKPWKNSGGFP
VRFPYPCTQTELAMIGEEECVLGLTDRCRFFINDIEVASNITSFAVYDEFLLLTTHSHTC
QCFCLRDASFKTLQAGLSSNHVSHGEVLRKVERGSRIVTVVPQDTKLVLQMPRGNLEVVH
HRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLGNVETFIKQIDSVNHI
NLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKIDLVCDAMRAVMESINPHKYCLSIL
TSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLHLVDVNELYDHSLGTYDF
DLVLMVAEKSQKDPKEYLPFLNTLKKMETNYQRFTIDKYLKRYEKAIGHLSKCGPEYFPE
CLNLIKDKNLYNEALKLYSPSSQQYQDISIAYGEHLMQEHMYEPAGLMFARCGAHEKALS
AFLTCGNWKQALCVAAQLNFTKDQLVGLGRTLAGKLVEQRKHIDAAMVLEECAQDYEEAV
LLLLEGAAWEEALRLVYKYNRLDIIETNVKPSILEAQKNYMAFLDSQTATFSRHKKRLLV
VRELKEQAQQAGLDDEVPHGQESDLFSETSSVVSGSEMSGKYSHSNSRISARSSKNRRKA
ERKKHSLKEGSPLEDLALLEALSEVVQNTENLKDEVYHILKVLFLFEFDEQGRELQKAFE
DTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKI
NRRTQWKLSLLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IJ07	0.858	0.871	0.000	1311	0.579	0.588	A0A0R4IJ07.pdb.gz	A0A0R4IJ07_DANRE Elongator complex protein 1 OS=Danio rerio OX=7955 GN=elp1 PE=1 SV=1
2	AFDB:O95163	1.000	1.000	0.000	1332	1.000	1.000	O95163.pdb.gz	ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3
3	AFDB:Q7TT37	0.938	0.938	0.000	1333	0.810	0.809	Q7TT37.pdb.gz	ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus OX=10090 GN=Elp1 PE=1 SV=2
4	AFDB:Q9VGK7	0.777	0.823	3.216E-76	1252	0.306	0.326	Q9VGK7.pdb.gz	ELP1_DROME Elongator complex protein 1 OS=Drosophila melanogaster OX=7227 GN=Elp1 PE=1 SV=2
5	AFDB:O59704	0.779	0.824	2.242E-71	1253	0.265	0.282	O59704.pdb.gz	ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp1 PE=3 SV=1
6	AFDB:Q06706	0.691	0.683	4.468E-70	1349	0.281	0.277	Q06706.pdb.gz	ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IKI3 PE=1 SV=1
7	AFDB:Q9FNA4	0.747	0.754	3.056E-67	1319	0.254	0.256	Q9FNA4.pdb.gz	ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana OX=3702 GN=ELP1 PE=1 SV=1
8	PDB:6qk7A	0.602	0.681	2.675E-56	1161	0.248	0.285	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
9	AFDB:Q9N595	0.718	0.782	8.953E-54	1211	0.194	0.213	Q9N595.pdb.gz	Q9N595_CAEEL Elongator complex protein 1 OS=Caenorhabditis elegans OX=6239 GN=elpc-1 PE=1 SV=3
10	AFDB:Q9W040	0.200	0.155	3.232E-22	1754	0.130	0.099	Q9W040.pdb.gz	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
11	AFDB:Q22830	0.197	0.154	7.310E-22	1737	0.107	0.082	Q22830.pdb.gz	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
12	PDB:7mq8LR	0.184	0.300	5.169E-13	773	0.071	0.123	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mqaLO	0.177	0.277	5.809E-13	819	0.088	0.143	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LO	0.177	0.267	2.446E-12	848	0.083	0.130	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5wyjBA	0.173	0.281	6.462E-12	755	0.085	0.150	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:7ajuUL	0.181	0.296	1.301E-11	779	0.072	0.123	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7mqaLQ	0.173	0.268	2.073E-11	830	0.075	0.120	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6lqsB1	0.180	0.287	2.422E-11	806	0.082	0.135	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:7ajtUA	0.172	0.264	3.713E-11	834	0.092	0.147	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:5a1vK	0.154	0.177	5.067E-11	1126	0.097	0.115	5a1vK.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IJ07	0.0	1529	1311	0.584	0.593	A0A0R4IJ07_DANRE Elongator complex protein 1 OS=Danio rerio OX=7955 GN=elp1 PE=1 SV=1
2	F5H2T0	0.0	2047	983	0.738	1.000	F5H2T0_HUMAN IkappaB kinase complex-associated protein OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=1
3	O95163	0.0	2774	1332	1.000	1.000	ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3
4	Q7TT37	0.0	2208	1333	0.811	0.810	ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus OX=10090 GN=Elp1 PE=1 SV=2
5	Q8VHU4	0.0	2225	1331	0.812	0.812	ELP1_RAT Elongator complex protein 1 OS=Rattus norvegicus OX=10116 GN=Elp1 PE=2 SV=1
6	Q9VGK7	4.44e-178	563	1252	0.315	0.335	ELP1_DROME Elongator complex protein 1 OS=Drosophila melanogaster OX=7227 GN=Elp1 PE=1 SV=2
7	O59704	4.63e-157	508	1253	0.282	0.300	ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp1 PE=3 SV=1
8	Q9FNA4	3.28e-106	369	1319	0.255	0.257	ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana OX=3702 GN=ELP1 PE=1 SV=1
9	Q06706	9.74e-86	309	1349	0.161	0.159	ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IKI3 PE=1 SV=1
10	Q9N595	1.16e-35	150	1211	0.117	0.129	Q9N595_CAEEL Elongator complex protein 1 OS=Caenorhabditis elegans OX=6239 GN=elpc-1 PE=1 SV=3
11	Q38CC3	0.22	38.5	1747	0.026	0.019	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
12	Q5PRA9	0.26	38.1	777	0.043	0.073	Q5PRA9_DANRE Intraflagellar transport 80 homolog (Chlamydomonas) OS=Danio rerio OX=7955 GN=wu:fj11a06 PE=2 SV=1
13	P55096	1.5	35.8	659	0.023	0.047	ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus OX=10090 GN=Abcd3 PE=1 SV=2
14	Q9NHF0	1.5	35.8	823	0.020	0.032	Q9NHF0_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1
15	Q38B65	1.6	35.8	1242	0.034	0.036	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
16	Q9P2H3	1.6	35.4	777	0.042	0.072	IFT80_HUMAN Intraflagellar transport protein 80 homolog OS=Homo sapiens OX=9606 GN=IFT80 PE=1 SV=3
17	P32480	1.7	35.4	875	0.020	0.031	HIR2_YEAST Protein HIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HIR2 PE=1 SV=2
18	Q8H136	1.7	35.4	619	0.044	0.095	RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana OX=3702 GN=RH14 PE=1 SV=2
19	Q0KHS0	1.8	35.4	819	0.020	0.032	Q0KHS0_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1
20	Q8K057	1.8	35.4	777	0.043	0.073	IFT80_MOUSE Intraflagellar transport protein 80 homolog OS=Mus musculus OX=10090 GN=Ift80 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4	20.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF05228 CHASE4	3.8e+02	12.6	CHASE4 domain
3	PF04762 IKI3	0	1050.5	IKI3 family
4	PF17119 MMU163	2.9e+02	12.0	Mitochondrial protein up-regulated during meiosis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363779

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256398	0.999	Elongator complex protein 3
2	9606.ENSP00000379267	0.999	Elongator complex protein 4
3	9606.ENSP00000414851	0.999	Elongator complex protein 2
4	9606.ENSP00000296149	0.989	Elongator complex protein 6
5	9606.ENSP00000379869	0.972	Elongator complex protein 5
6	9606.ENSP00000360676	0.970	KTI12 chromatin associated homolog
7	9606.ENSP00000412922	0.891	Ubiquitin-related modifier 1
8	9606.ENSP00000419599	0.862	DPH3 homolog
9	9606.ENSP00000360412	0.846	Nucleolar complex protein 3 homolog
10	9606.ENSP00000244051	0.833	Adenylyltransferase and sulfurtransferase MOCS3
11	9606.ENSP00000390011	0.827	Cytoplasmic tRNA 2-thiolation protein 1
12	9606.ENSP00000483495	0.821	Probable ATP-dependent RNA helicase DDX27
13	9606.ENSP00000444136	0.815	DNA-directed RNA polymerase I subunit RPA2
14	9606.ENSP00000388320	0.812	Cytoplasmic tRNA 2-thiolation protein 2
15	9606.ENSP00000387498	0.801	Galactoside 2-alpha-L-fucosyltransferase 2
16	9606.ENSP00000263857	0.786	DNA-directed RNA polymerase I subunit RPA1
17	9606.ENSP00000216122	0.760	DNA replication licensing factor MCM5
18	9606.ENSP00000380982	0.758	Pumilio homolog 3
19	9606.ENSP00000397673	0.703	Alkylated DNA repair protein alkB homolog 8
20	9606.ENSP00000332448	0.683	Probable inactive tRNA-specific adenosine deaminase-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043621	0.983	protein self-association
GO:1901363	0.466	heterocyclic compound binding
GO:0097159	0.466	organic cyclic compound binding
GO:0003824	0.379	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0043412	0.927	macromolecule modification
GO:0050789	0.899	regulation of biological process
GO:0050794	0.865	regulation of cellular process
GO:0006725	0.764	cellular aromatic compound metabolic process
GO:1901360	0.760	organic cyclic compound metabolic process
GO:0046483	0.717	heterocycle metabolic process
GO:0034470	0.664	ncRNA processing
GO:0006399	0.508	tRNA metabolic process
GO:0009451	0.505	RNA modification
GO:0050896	0.420	response to stimulus
GO:0006400	0.410	tRNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0032991	0.992	protein-containing complex
GO:0140535	0.982	intracellular protein-containing complex
GO:1902494	0.979	catalytic complex
GO:0031981	0.967	nuclear lumen
GO:0005654	0.954	nucleoplasm
GO:0033588	0.506	elongator holoenzyme complex
GO:0012505	0.331	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]