StarFunc result for job id O95166

User Input

>input (117 residues)
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QY33	0.994	0.766	2.325E-24	152	0.983	0.757	F1QY33.pdb.gz	F1QY33_DANRE GABA(A) receptor-associated protein b OS=Danio rerio OX=7955 GN=gabarapb PE=3 SV=2
2	PDB:7lswC	0.991	0.801	3.272E-24	145	1.000	0.807	7lswC.pdb.gz
3	AFDB:Q9W2S2	0.990	0.957	1.074E-23	121	0.915	0.884	Q9W2S2.pdb.gz	Q9W2S2_DROME Autophagy-related 8a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
4	PDB:7bruA	0.983	0.835	1.158E-23	138	0.974	0.826	7bruA.pdb.gz
5	PDB:5yipA	0.987	0.939	6.112E-23	123	0.863	0.821	5yipA.pdb.gz	Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
6	AFDB:Q0VGK0	0.995	0.995	7.395E-23	117	0.863	0.863	Q0VGK0.pdb.gz	GBRL1_RAT Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Gabarapl1 PE=1 SV=1
7	AFDB:Q09490	0.985	0.937	1.259E-22	123	0.829	0.789	Q09490.pdb.gz	LGG1_CAEEL Protein lgg-1 OS=Caenorhabditis elegans OX=6239 GN=lgg-1 PE=1 SV=1
8	PDB:7aa8C	0.938	0.827	1.772E-22	133	0.957	0.842	7aa8C.pdb.gz
9	AFDB:Q6NZZ7	0.984	0.707	2.990E-22	163	0.974	0.699	Q6NZZ7.pdb.gz	Q6NZZ7_DANRE Gabarap protein (Fragment) OS=Danio rerio OX=7955 GN=gabarap PE=2 SV=1
10	PDB:5azfA	0.946	0.930	1.026E-20	119	0.829	0.815	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
11	AFDB:Q7K1J3	0.971	0.721	5.364E-20	158	0.769	0.570	Q7K1J3.pdb.gz	Q7K1J3_DROME AT01047p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=2 SV=1
12	AFDB:P60519	0.983	0.983	6.721E-19	117	0.573	0.573	P60519.pdb.gz	GBRL2_BOVIN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Bos taurus OX=9913 GN=GABARAPL2 PE=1 SV=1
13	AFDB:Q8VYK7	0.972	0.940	6.721E-19	121	0.581	0.562	Q8VYK7.pdb.gz	ATG8F_ARATH Autophagy-related protein 8f OS=Arabidopsis thaliana OX=3702 GN=ATG8F PE=1 SV=1
14	AFDB:Q8S926	0.967	0.928	1.144E-18	122	0.564	0.541	Q8S926.pdb.gz	ATG8E_ARATH Autophagy-related protein 8e OS=Arabidopsis thaliana OX=3702 GN=ATG8E PE=1 SV=2
15	AFDB:O94272	0.974	0.943	3.546E-18	121	0.556	0.537	O94272.pdb.gz	ATG8_SCHPO Autophagy-related protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg8 PE=1 SV=1
16	PDB:6aagC	0.933	0.789	3.672E-17	139	0.556	0.468	6aagC.pdb.gz
17	PDB:7yo8A	0.918	0.769	5.474E-17	140	0.581	0.486	7yo8A.pdb.gz
18	PDB:5l83B	0.902	0.941	9.962E-17	112	0.564	0.589	5l83B.pdb.gz	Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
19	PDB:7brnA	0.913	0.807	2.213E-16	133	0.547	0.481	7brnA.pdb.gz	Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes.
20	PDB:6aafA	0.934	0.975	2.888E-16	112	0.538	0.562	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95166	1.09e-82	239	117	1.000	1.000	GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1
2	P60517	1.09e-82	239	117	1.000	1.000	GBRAP_RAT Gamma-aminobutyric acid receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Gabarap PE=1 SV=1
3	Q6IAW1	1.09e-82	239	117	1.000	1.000	Q6IAW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1
4	Q9DCD6	1.09e-82	239	117	1.000	1.000	GBRAP_MOUSE Gamma-aminobutyric acid receptor-associated protein OS=Mus musculus OX=10090 GN=Gabarap PE=1 SV=2
5	F1QY33	8.91e-82	238	152	0.983	0.757	F1QY33_DANRE GABA(A) receptor-associated protein b OS=Danio rerio OX=7955 GN=gabarapb PE=3 SV=2
6	Q6NZZ7	1.96e-80	234	163	0.974	0.699	Q6NZZ7_DANRE Gabarap protein (Fragment) OS=Danio rerio OX=7955 GN=gabarap PE=2 SV=1
7	Q6PSS4	2.30e-80	233	122	0.974	0.934	Q6PSS4_DANRE GABA(A) receptor-associated protein OS=Danio rerio OX=7955 GN=gabarap PE=3 SV=1
8	Q9W2S2	1.92e-76	223	121	0.915	0.884	Q9W2S2_DROME Autophagy-related 8a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
9	Q0VGK0	4.14e-72	212	117	0.863	0.863	GBRL1_RAT Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Gabarapl1 PE=1 SV=1
10	Q8R3R8	4.14e-72	212	117	0.863	0.863	GBRL1_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Mus musculus OX=10090 GN=Gabarapl1 PE=1 SV=2
11	Q9H0R8	4.14e-72	212	117	0.863	0.863	GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Homo sapiens OX=9606 GN=GABARAPL1 PE=1 SV=1
12	Q09490	5.84e-69	204	123	0.829	0.789	LGG1_CAEEL Protein lgg-1 OS=Caenorhabditis elegans OX=6239 GN=lgg-1 PE=1 SV=1
13	Q9VEG5	3.71e-65	194	120	0.769	0.750	Q9VEG5_DROME Autophagy-related 8b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=1 SV=1
14	Q7K1J3	1.04e-64	195	158	0.769	0.570	Q7K1J3_DROME AT01047p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg8b PE=2 SV=1
15	X2JEE0	1.08e-57	175	107	0.718	0.785	X2JEE0_DROME Autophagy-related 8a, isoform C OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
16	X2JJA8	1.15e-56	172	96	0.701	0.854	X2JJA8_DROME Autophagy-related 8a, isoform B OS=Drosophila melanogaster OX=7227 GN=Atg8a PE=1 SV=1
17	M1C146	2.79e-48	152	119	0.581	0.571	ATG8C_SOLTU Autophagy-related protein 8C-like OS=Solanum tuberosum OX=4113 GN=ATG8CL PE=1 SV=1
18	A2QPN1	3.44e-48	152	118	0.590	0.585	ATG8_ASPNC Autophagy-related protein 8 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=atg8 PE=3 SV=1
19	Q2UBH5	4.24e-48	151	118	0.590	0.585	ATG8_ASPOR Autophagy-related protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg8 PE=3 SV=1
20	Q9SL04	1.44e-47	150	120	0.556	0.542	ATG8D_ARATH Autophagy-related protein 8d OS=Arabidopsis thaliana OX=3702 GN=ATG8D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04110 APG12	0.00012	33.7	Ubiquitin-like autophagy protein Apg12
2	PF02991 ATG8	3.8e-45	163.7	Autophagy protein Atg8 ubiquitin like
3	PF20111 DUF6501	6.9	17.9	Family of unknown function (DUF6501)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008854069.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008845221.1	0.990	Autophagy related 3
2	1026970.XP_008853122.1	0.990	Autophagy related 7
3	1026970.XP_008853745.1	0.988	NBR1, autophagy cargo receptor
4	1026970.XP_008827384.1	0.983	Autophagy related 4B cysteine peptidase
5	1026970.XP_008850471.1	0.982	Sequestosome 1
6	1026970.XP_008823493.1	0.980	Autophagy related 12
7	1026970.XP_008848522.1	0.979	Autophagy protein 5
8	1026970.XP_008836330.1	0.978	Autophagy-related protein 16-1 isoform X1
9	1026970.XP_008833560.1	0.974	Beclin-1 isoform X1
10	1026970.XP_008849982.1	0.971	WD repeat and FYVE domain containing 3
11	1026970.XP_008851187.1	0.971	Autophagy related 4A cysteine peptidase
12	1026970.XP_008845622.1	0.950	Gamma-aminobutyric acid receptor-associated protein-like 1
13	1026970.XP_008821177.1	0.949	GABA type A receptor associated protein like 2
14	1026970.XP_008821367.1	0.946	BCL2 interacting protein 3
15	1026970.XP_008829191.1	0.946	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
16	1026970.XP_008829303.1	0.944	Autophagy related 4C cysteine peptidase
17	1026970.XP_008848256.1	0.944	Autophagy related 4D cysteine peptidase
18	1026970.XP_008819899.1	0.943	Gamma-aminobutyric acid type A receptor gamma2 subunit
19	1026970.XP_008847574.1	0.943	FUN14 domain-containing protein 1
20	1026970.XP_008846755.1	0.939	Optineurin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.757	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032502	0.954	developmental process
GO:0051179	0.910	localization
GO:0048856	0.854	anatomical structure development
GO:0065007	0.842	biological regulation
GO:0050789	0.833	regulation of biological process
GO:0051234	0.791	establishment of localization
GO:0051641	0.785	cellular localization
GO:0006810	0.780	transport
GO:0008152	0.765	metabolic process
GO:0050794	0.679	regulation of cellular process
GO:0044237	0.644	cellular metabolic process
GO:0071840	0.620	cellular component organization or biogenesis
GO:0016043	0.576	cellular component organization
GO:0033036	0.571	macromolecule localization
GO:0006914	0.570	autophagy
GO:0008104	0.555	protein localization
GO:0019222	0.427	regulation of metabolic process
GO:0006996	0.419	organelle organization
GO:0032501	0.417	multicellular organismal process
GO:0071705	0.400	nitrogen compound transport
GO:0060322	0.397	head development
GO:0071702	0.397	organic substance transport
GO:0050896	0.373	response to stimulus
GO:0016236	0.359	macroautophagy
GO:0048518	0.348	positive regulation of biological process
GO:0031323	0.319	regulation of cellular metabolic process
GO:0048522	0.305	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005773	0.996	vacuole
GO:0071944	0.986	cell periphery
GO:0016020	0.980	membrane
GO:0005829	0.972	cytosol
GO:0005886	0.968	plasma membrane
GO:0005776	0.954	autophagosome
GO:0031090	0.903	organelle membrane
GO:0098588	0.740	bounding membrane of organelle
GO:0012505	0.732	endomembrane system
GO:0120025	0.686	plasma membrane bounded cell projection
GO:0005764	0.434	lysosome
GO:0044297	0.426	cell body
GO:0043232	0.406	intracellular non-membrane-bounded organelle
GO:0005739	0.354	mitochondrion
GO:0032991	0.351	protein-containing complex
GO:0045202	0.347	synapse
GO:0005774	0.334	vacuolar membrane
GO:0043005	0.320	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]