StarFunc result for job id O95168

User Input

>input (129 residues)
MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLI
ENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK
LDRTFHLSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95168	1.000	1.000	1.628E-21	129	1.000	1.000	O95168.pdb.gz	NDUB4_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Homo sapiens OX=9606 GN=NDUFB4 PE=1 SV=3
2	PDB:5xtco	0.928	0.935	5.982E-19	128	0.992	1.000	5xtco.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
3	AFDB:Q9CQC7	0.990	0.990	1.741E-18	129	0.752	0.752	Q9CQC7.pdb.gz	NDUB4_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Mus musculus OX=10090 GN=Ndufb4 PE=1 SV=3
4	AFDB:P48305	0.994	0.994	5.256E-18	129	0.736	0.736	P48305.pdb.gz	NDUB4_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Bos taurus OX=9913 GN=NDUFB4 PE=1 SV=2
5	PDB:7qskm	0.953	0.960	1.138E-16	128	0.729	0.734	7qskm.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
6	PDB:6zr2m	0.925	0.946	1.163E-14	126	0.736	0.754	6zr2m.pdb.gz	Structure of inhibitor-bound mammalian complex I.
7	PDB:6elzJ	0.246	0.229	4.803E-1	145	0.116	0.103	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
8	PDB:7rjeF	0.235	0.331	4.377	88	0.093	0.136	7rjeF.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
9	AFDB:O94683	0.246	0.162	4.521	238	0.101	0.055	O94683.pdb.gz	RRP7_SCHPO Ribosomal RNA-processing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp7 PE=3 SV=2
10	AFDB:Q02637	0.212	0.087	5.191	449	0.147	0.042	Q02637.pdb.gz	CEBP_DROME CCAAT/enhancer-binding protein OS=Drosophila melanogaster OX=7227 GN=slbo PE=1 SV=3
11	PDB:7v2wJ	0.202	0.114	5.770	236	0.140	0.076	7v2wJ.pdb.gz
12	AFDB:F1R3S8	0.197	0.196	5.959	132	0.186	0.182	F1R3S8.pdb.gz	F1R3S8_DANRE Neuromedin U OS=Danio rerio OX=7955 GN=si:rp71-4m17.1 PE=4 SV=2
13	AFDB:R4GDN9	0.190	0.163	5.959	157	0.147	0.121	R4GDN9.pdb.gz
14	PDB:3feyA	0.158	0.034	6.182	761	0.039	0.007	3feyA.pdb.gz
15	AFDB:A0A2R8QC71	0.242	0.213	6.385	149	0.155	0.134	A0A2R8QC71.pdb.gz
16	AFDB:Q2R1U8	0.258	0.051	6.385	886	0.116	0.017	Q2R1U8.pdb.gz	CFM3_ORYSJ CRM-domain containing factor CFM3, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=CFM3 PE=3 SV=1
17	PDB:7r5sW	0.158	0.224	6.624	88	0.078	0.114	7r5sW.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
18	AFDB:A7SDT1	0.240	0.069	6.842	598	0.163	0.035	A7SDT1.pdb.gz	A7SDT1_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g244559 PE=1 SV=1
19	PDB:3b0dC	0.204	0.337	8.149	75	0.070	0.120	3b0dC.pdb.gz
20	PDB:3lutB	0.144	0.059	8.149	390	0.116	0.038	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95168	3.28e-92	264	129	1.000	1.000	NDUB4_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Homo sapiens OX=9606 GN=NDUFB4 PE=1 SV=3
2	Q9CQC7	6.11e-70	207	129	0.752	0.752	NDUB4_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Mus musculus OX=10090 GN=Ndufb4 PE=1 SV=3
3	P48305	2.38e-68	203	129	0.736	0.736	NDUB4_BOVIN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Bos taurus OX=9913 GN=NDUFB4 PE=1 SV=2
4	Q6IDF5	2.85e-04	40.0	113	0.209	0.239	Q6IDF5_DROME NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Drosophila melanogaster OX=7227 GN=ND-B15 PE=1 SV=1
5	Q8IKZ6	0.78	31.6	1024	0.109	0.014	Q8IKZ6_PLAF7 Multidrug resistance protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1447900 PE=4 SV=1
6	P24100	1.6	30.4	294	0.132	0.058	CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana OX=3702 GN=CDKA-1 PE=1 SV=1
7	P29618	2.5	29.6	294	0.124	0.054	CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1
8	Q4WYQ4	3.6	29.6	493	0.202	0.053	Q4WYQ4_ASPFU GATA-type sexual development transcription factor NsdD OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G13870 PE=4 SV=1
9	Q9MAC8	7.6	28.5	792	0.124	0.020	SSY2_ARATH Starch synthase 2, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07225 NDUF_B4	3.7e-57	203.0	NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013576

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000007730	0.993	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
2	9593.ENSGGOP00000013040	0.993	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
3	9593.ENSGGOP00000015492	0.993	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
4	9593.ENSGGOP00000012562	0.992	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
5	9593.ENSGGOP00000002288	0.991	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
6	9593.ENSGGOP00000025893	0.991	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
7	9593.ENSGGOP00000010000	0.990	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
8	9593.ENSGGOP00000026477	0.990	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
9	9593.ENSGGOP00000001226	0.989	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
10	9593.ENSGGOP00000004732	0.989	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
11	9593.ENSGGOP00000006141	0.989	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
12	9593.ENSGGOP00000009152	0.989	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
13	9593.ENSGGOP00000024682	0.989	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
14	9593.ENSGGOP00000000912	0.988	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
15	9593.ENSGGOP00000005070	0.988	NADH dehydrogenase [ubiquinone] 1 subunit C2
16	9593.ENSGGOP00000027611	0.987	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
17	9593.ENSGGOP00000016543	0.984	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
18	9593.ENSGGOP00000017605	0.984	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
19	9593.ENSGGOP00000014036	0.983	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)
20	9593.ENSGGOP00000005115	0.982	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0009055	0.999	electron transfer activity
GO:0015453	0.999	oxidoreduction-driven active transmembrane transporter activity
GO:0016651	0.370	oxidoreductase activity, acting on NAD(P)H
GO:0003955	0.347	NAD(P)H dehydrogenase (quinone) activity
GO:0003954	0.330	NADH dehydrogenase activity
GO:0050136	0.307	NADH dehydrogenase (quinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032981	0.986	mitochondrial respiratory chain complex I assembly
GO:0050896	0.881	response to stimulus
GO:0006979	0.693	response to oxidative stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.995	intracellular organelle lumen
GO:0005747	0.995	mitochondrial respiratory chain complex I
GO:0005634	0.973	nucleus
GO:0031981	0.936	nuclear lumen
GO:0005654	0.934	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	1.000	Translocases.
EC:1.-.-.-	0.999	Oxidoreductases.
EC:1.6.-.-	0.370	Acting on NADH or NADPH.
EC:1.6.5.2	0.347	NAD(P)H dehydrogenase (quinone).
RHEA:11356	0.330	A + H(+) + NADH = AH2 + NAD(+)
RHEA:46160	0.307	a quinone + H(+) + NADH = a quinol + NAD(+)
EC:1.6.5.11	0.307	Transferred entry: 1.6.5.9.

[back to server]