StarFunc result for job id O95180

User Input

>input (2353 residues)
MTEGARAADEVRVPLGAPPPGPAALVGASPESPGAPGREAERGSELGVSPSESPAAERGA
ELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMF
RPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVV
AGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFV
FFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQ
KCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSGDSNPHNGAIN
FDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT
QFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYA
RWQSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPG
PEPGACDTRLVRAGAPPSPPSPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAA
SLRLATGLGTMNYPTILPSGVGSGKGSTSPGPKGKWAGGPPGTGGHGPLSLNSPDPYEKI
PHVVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSESG
DSDGRGVYEFTQDVRHGDRWDPTRPPRATDTPGPGPGSPQRRAQQRAAPGEPGWMGRLWV
TFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEM
LLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPA
LRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSL
LWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQA
EGDANRSDTDEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLEGRGSLSPPLIMCT
AATPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPWGPSGAWSS
RRSSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAPGPRATPLRRAESLD
PRPLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEP
YKPQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDP
GSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIV
VAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAF
FIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRAAHYRWVRRKYNFDNLGQALMSLFVL
SSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHK
CRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTSHYLD
LFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDR
WNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLD
TVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLT
LFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLM
KHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVARKVS
VSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQ
IPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDSPRDTLDPAEP
GEKTPVRPVTQGGSLQSPPRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEASDPADEE
VSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAEL
GSGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPSAAEGGSTTLRRRT
PSCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSGDP
FLDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPS
ATPAPGGGADDPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54898	0.606	0.631	0.000	2254	0.564	0.589	O54898.pdb.gz	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
2	AFDB:O88427	0.721	0.718	0.000	2365	0.851	0.847	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
3	AFDB:O95180	1.000	1.000	0.000	2353	1.000	1.000	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
4	AFDB:Q5SUF7	0.588	0.581	0.000	2381	0.560	0.554	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
5	AFDB:Q9P0X4	0.604	0.637	0.000	2223	0.532	0.563	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
6	AFDB:Q9Z0Y8	0.585	0.623	0.000	2201	0.526	0.562	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
7	PDB:7wliA	0.469	0.960	2.749E-101	1135	0.399	0.828	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
8	PDB:6kzoA	0.404	0.971	3.750E-80	967	0.346	0.842	6kzoA.pdb.gz	Cryo-EM structures of apo and antagonist-bound human Cav3.1.
9	AFDB:P35500	0.459	0.505	2.947E-71	2131	0.190	0.210	P35500.pdb.gz	SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster OX=7227 GN=para PE=2 SV=3
10	AFDB:Q15878	0.458	0.465	4.615E-65	2313	0.231	0.235	Q15878.pdb.gz	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
11	AFDB:A0A0R4IFN9	0.446	0.452	9.820E-65	2319	0.230	0.234	A0A0R4IFN9.pdb.gz
12	AFDB:Q00975	0.447	0.450	8.700E-64	2339	0.238	0.240	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
13	PDB:7vfsA	0.430	0.775	3.197E-52	1266	0.164	0.306	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
14	PDB:7xveA	0.434	0.775	8.086E-51	1276	0.157	0.289	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
15	PDB:7w9lA	0.443	0.720	1.455E-50	1420	0.156	0.258	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
16	PDB:7mixA	0.433	0.746	2.132E-49	1326	0.162	0.288	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
17	PDB:6j8gA	0.434	0.868	1.415E-47	1140	0.150	0.310	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
18	PDB:7we4A	0.427	0.867	1.980E-47	1122	0.137	0.287	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
19	PDB:7uhfA	0.404	0.756	4.059E-46	1230	0.163	0.312	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
20	PDB:6j8eA	0.432	0.867	1.690E-45	1139	0.147	0.304	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8JUY8	758	3205	0.168	0.124	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
2	E0CXK2	1467	1835	0.358	0.459	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
3	E9PWL1	2058	2272	0.559	0.579	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
4	E9Q7P2	1468	2199	0.359	0.384	E9Q7P2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
5	G5EBS2	1001	1837	0.253	0.324	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
6	M9NDQ0	758	3200	0.168	0.124	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
7	M9NGR9	758	3180	0.168	0.125	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
8	M9PGH9	758	3218	0.168	0.123	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
9	O43497	2004	2377	0.503	0.498	CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens OX=9606 GN=CACNA1G PE=1 SV=3
10	O54898	2065	2254	0.563	0.587	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
11	O88427	3676	2365	0.851	0.847	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
12	O95180	4825	2353	1.000	1.000	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
13	Q27YN9	2055	2265	0.563	0.585	Q27YN9_MOUSE T-type calcium channel alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
14	Q3UQG9	672	853	0.193	0.532	Q3UQG9_MOUSE Ion transport domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
15	Q5SUF5	2061	2247	0.565	0.591	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
16	Q5SUF6	2046	2288	0.564	0.580	Q5SUF6_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q5SUF7	1981	2381	0.503	0.497	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	Q5SUF8	2065	2254	0.566	0.591	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q5SUF9	2057	2265	0.564	0.585	Q5SUF9_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
20	Q5SUG0	2055	2277	0.566	0.585	Q5SUG0_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16118 DUF4834	7.6e+02	12.5	Domain of unknown function (DUF4834)
2	PF14851 FAM176	6.2e+02	11.5	FAM176 family
3	PF00520 Ion_trans	5.1e-253	846.4	Ion transport protein
4	PF01741 MscL	6.2e+02	12.1	Large-conductance mechanosensitive channel, MscL
5	PF08016 PKD_channel	3.9e-17	74.0	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341940	0.936	Caveolin-3
2	9606.ENSP00000438949	0.909	Voltage-dependent L-type calcium channel subunit beta-4
3	9606.ENSP00000349320	0.906	Voltage-dependent calcium channel subunit alpha-2/delta-1
4	9606.ENSP00000229268	0.894	Ubiquitin carboxyl-terminal hydrolase 5
5	9606.ENSP00000320025	0.894	Voltage-dependent L-type calcium channel subunit beta-2
6	9606.ENSP00000226021	0.890	Voltage-dependent calcium channel gamma-1 subunit
7	9606.ENSP00000301050	0.880	Voltage-dependent L-type calcium channel subunit beta-3
8	9606.ENSP00000419313	0.877	Short transient receptor potential channel 1
9	9606.ENSP00000418081	0.864	Voltage-dependent calcium channel subunit alpha-2/delta-2
10	9606.ENSP00000262138	0.861	Voltage-dependent calcium channel gamma-4 subunit
11	9606.ENSP00000372169	0.860	Voltage-dependent calcium channel subunit alpha-2/delta-4
12	9606.ENSP00000005284	0.848	Voltage-dependent calcium channel gamma-3 subunit
13	9606.ENSP00000352608	0.846	Ryanodine receptor 1
14	9606.ENSP00000262839	0.843	Short transient receptor potential channel 5
15	9606.ENSP00000377840	0.842	Voltage-dependent L-type calcium channel subunit beta-1
16	9606.ENSP00000369027	0.839	Short transient receptor potential channel 4
17	9606.ENSP00000270458	0.834	Voltage-dependent calcium channel gamma-8 subunit
18	9606.ENSP00000375647	0.831	Voltage-dependent calcium channel gamma-7 subunit
19	9606.ENSP00000300105	0.825	Voltage-dependent calcium channel gamma-2 subunit
20	9606.ENSP00000266376	0.824	Voltage-dependent L-type calcium channel subunit alpha-1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008332	0.999	low voltage-gated calcium channel activity
GO:0097110	0.583	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050896	0.922	response to stimulus
GO:0065008	0.922	regulation of biological quality
GO:0044057	0.916	regulation of system process
GO:0051179	0.914	localization
GO:1903522	0.913	regulation of blood circulation
GO:0008016	0.880	regulation of heart contraction
GO:0050794	0.846	regulation of cellular process
GO:0042391	0.804	regulation of membrane potential
GO:0030001	0.770	metal ion transport
GO:0071702	0.659	organic substance transport
GO:0055085	0.614	transmembrane transport
GO:0098660	0.595	inorganic ion transmembrane transport
GO:0098662	0.589	inorganic cation transmembrane transport
GO:0032501	0.579	multicellular organismal process
GO:0042221	0.553	response to chemical
GO:0006816	0.527	calcium ion transport
GO:0034220	0.482	monoatomic ion transmembrane transport
GO:0098655	0.473	monoatomic cation transmembrane transport
GO:0007154	0.443	cell communication
GO:0003008	0.397	system process
GO:0023052	0.367	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.989	protein-containing complex
GO:0098796	0.978	membrane protein complex
GO:0034703	0.970	cation channel complex
GO:0098797	0.962	plasma membrane protein complex
GO:0034704	0.899	calcium channel complex
GO:0005891	0.598	voltage-gated calcium channel complex
GO:0005622	0.497	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]