StarFunc result for job id O95182

User Input

>input (113 residues)
MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGR
RESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95182	1.000	1.000	2.785E-19	113	1.000	1.000	O95182.pdb.gz	NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3
2	AFDB:Q05752	0.947	0.947	4.159E-18	113	0.885	0.885	Q05752.pdb.gz	NDUA7_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Bos taurus OX=9913 GN=NDUFA7 PE=1 SV=2
3	PDB:7b93r	0.823	0.916	6.471E-14	101	0.823	0.921	7b93r.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
4	PDB:7qsor	0.813	0.951	2.593E-13	96	0.761	0.896	7qsor.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
5	AFDB:Q6QHK4	0.148	0.086	1.468	219	0.168	0.087	Q6QHK4.pdb.gz	FIGLA_HUMAN Factor in the germline alpha OS=Homo sapiens OX=9606 GN=FIGLA PE=1 SV=2
6	AFDB:A6YRS1	0.153	0.058	3.280	452	0.221	0.055	A6YRS1.pdb.gz	A6YRS1_MAIZE R-interacting factor 1 OS=Zea mays OX=4577 GN=rif1 PE=1 SV=1
7	AFDB:Q7KUD4	0.143	0.030	3.280	887	0.150	0.019	Q7KUD4.pdb.gz	Q7KUD4_DROME phospholipase A2 OS=Drosophila melanogaster OX=7227 GN=iPLA2-VIA PE=1 SV=1
8	AFDB:Q02223	0.165	0.117	4.393	184	0.124	0.076	Q02223.pdb.gz	TNR17_HUMAN Tumor necrosis factor receptor superfamily member 17 OS=Homo sapiens OX=9606 GN=TNFRSF17 PE=1 SV=2
9	AFDB:Q04089	0.121	0.046	4.393	582	0.168	0.033	Q04089.pdb.gz	DOT1_YEAST Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOT1 PE=1 SV=1
10	AFDB:Q08345	0.145	0.027	5.470	913	0.221	0.027	Q08345.pdb.gz	DDR1_HUMAN Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1
11	AFDB:Q8GYY1	0.143	0.055	5.470	412	0.124	0.034	Q8GYY1.pdb.gz	HSFA3_ARATH Heat stress transcription factor A-3 OS=Arabidopsis thaliana OX=3702 GN=HSFA3 PE=1 SV=2
12	PDB:7dvqR	0.129	0.084	6.379	241	0.124	0.058	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
13	AFDB:A2RRU1	0.140	0.039	6.810	738	0.124	0.019	A2RRU1.pdb.gz	GYS1_RAT Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1
14	PDB:2kfwA	0.113	0.083	7.943	196	0.071	0.041	2kfwA.pdb.gz
15	PDB:2ji4A	0.128	0.054	8.545	302	0.027	0.010	2ji4A.pdb.gz
16	PDB:7qenC	0.116	0.056	8.545	291	0.062	0.024	7qenC.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
17	PDB:3j79V	0.133	0.110	9.193	155	0.062	0.045	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:6o9lQ	0.143	0.055	9.193	430	0.142	0.037	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
19	PDB:7bvfA	0.114	0.015	9.889	1087	0.080	0.008	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95182	2.04e-79	230	113	1.000	1.000	NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3
2	Q9Z1P6	5.39e-73	214	113	0.912	0.912	NDUA7_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Mus musculus OX=10090 GN=Ndufa7 PE=1 SV=3
3	Q05752	4.26e-71	209	113	0.885	0.885	NDUA7_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Bos taurus OX=9913 GN=NDUFA7 PE=1 SV=2
4	K4D3V7	3.4	29.3	475	0.124	0.029	U76E1_SOLLC UDP-glycosyltransferase 76E1 OS=Solanum lycopersicum OX=4081 GN=UGT76E1 PE=1 SV=1
5	P14335	3.6	29.3	3433	0.106	0.003	POLG_KUNJM Genome polyprotein OS=Kunjin virus (strain MRM61C) OX=11078 PE=1 SV=1
6	Q7X3G5	4.4	28.9	405	0.186	0.052	CRTC_THIRO Acyclic carotenoid 1,2-hydratase OS=Thiocapsa roseopersicina OX=1058 GN=crtC PE=1 SV=1
7	P9WIR5	4.8	28.5	152	0.168	0.125	CADI_MYCTU Cadmium-induced protein CadI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cadI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07347 CI-B14_5a	6.5e-33	123.8	NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000017727

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000000990	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
2	9598.ENSPTRP00000005010	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
3	9598.ENSPTRP00000006209	0.999	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)
4	9598.ENSPTRP00000007076	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
5	9598.ENSPTRP00000007791	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
6	9598.ENSPTRP00000013017	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
7	9598.ENSPTRP00000013471	0.999	Acyl carrier protein, mitochondrial
8	9598.ENSPTRP00000018081	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
9	9598.ENSPTRP00000018326	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
10	9598.ENSPTRP00000028668	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
11	9598.ENSPTRP00000028892	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
12	9598.ENSPTRP00000029614	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
13	9598.ENSPTRP00000035176	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
14	9598.ENSPTRP00000036436	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
15	9598.ENSPTRP00000037483	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
16	9598.ENSPTRP00000047122	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
17	9598.ENSPTRP00000048498	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
18	9598.ENSPTRP00000054899	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
19	9598.ENSPTRP00000058761	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
20	9598.ENSPTRP00000002642	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003735	0.831	structural constituent of ribosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006119	0.995	oxidative phosphorylation
GO:0022904	0.985	respiratory electron transport chain
GO:0042773	0.984	ATP synthesis coupled electron transport
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.970	primary metabolic process
GO:0042775	0.957	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.956	aerobic electron transport chain
GO:0006807	0.946	nitrogen compound metabolic process
GO:0006120	0.941	mitochondrial electron transport, NADH to ubiquinone
GO:0034641	0.928	cellular nitrogen compound metabolic process
GO:1901576	0.903	organic substance biosynthetic process
GO:0043170	0.901	macromolecule metabolic process
GO:0044249	0.901	cellular biosynthetic process
GO:1901564	0.888	organonitrogen compound metabolic process
GO:0044271	0.868	cellular nitrogen compound biosynthetic process
GO:1901566	0.805	organonitrogen compound biosynthetic process
GO:0010467	0.788	gene expression
GO:0019538	0.773	protein metabolic process
GO:0043603	0.751	amide metabolic process
GO:0034645	0.748	cellular macromolecule biosynthetic process
GO:0043604	0.648	amide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.996	catalytic complex
GO:0098800	0.996	inner mitochondrial membrane protein complex
GO:0005747	0.987	mitochondrial respiratory chain complex I
GO:0070013	0.476	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]